Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NGS6

Protein Details
Accession A0A1Y3NGS6   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-35KEYLKFGKKVKKEKYNEIQVKRBasic
101-127LYKSQIKIKRINGTKKKVLRKSANINCHydrophilic
NLS Segment(s)
PositionSequence
115-117KKK
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 4
Family & Domain DBs
Amino Acid Sequences MDDIVIDFLSLPEKEYLKFGKKVKKEKYNEIQVKRALESVVKKEKYSKKEAITLIKNLLLTSQHVPFERKDFYAHWGKTICYVTNFINKGESINYKILYALYKSQIKIKRINGTKKKVLRKSANINC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.26
4 0.29
5 0.36
6 0.41
7 0.47
8 0.55
9 0.65
10 0.71
11 0.75
12 0.75
13 0.79
14 0.82
15 0.83
16 0.84
17 0.79
18 0.75
19 0.68
20 0.64
21 0.54
22 0.45
23 0.34
24 0.29
25 0.29
26 0.3
27 0.36
28 0.35
29 0.34
30 0.42
31 0.49
32 0.51
33 0.54
34 0.53
35 0.47
36 0.52
37 0.56
38 0.54
39 0.5
40 0.46
41 0.4
42 0.35
43 0.31
44 0.24
45 0.21
46 0.14
47 0.12
48 0.12
49 0.12
50 0.13
51 0.14
52 0.15
53 0.15
54 0.19
55 0.18
56 0.17
57 0.17
58 0.16
59 0.21
60 0.28
61 0.28
62 0.27
63 0.26
64 0.26
65 0.28
66 0.29
67 0.25
68 0.17
69 0.2
70 0.19
71 0.25
72 0.26
73 0.22
74 0.22
75 0.21
76 0.2
77 0.21
78 0.21
79 0.18
80 0.2
81 0.2
82 0.18
83 0.19
84 0.19
85 0.17
86 0.17
87 0.17
88 0.2
89 0.24
90 0.25
91 0.33
92 0.39
93 0.42
94 0.48
95 0.51
96 0.55
97 0.6
98 0.71
99 0.73
100 0.75
101 0.8
102 0.81
103 0.85
104 0.83
105 0.85
106 0.84
107 0.83