Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MNS3

Protein Details
Accession A0A1Y3MNS3   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
189-209SLDYDRKYKKFYKNNSEIIKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF12796  Ank_2  
Amino Acid Sequences MSKLILFTIVNNNIESVKLLMDYANQHQLILELNDINNDETYPLLEAIYKNNVEMVKLIMKYANEHQIILELNDLRKYGTYYPLLKAVDYNNTEMVELLIEYANQHQLILELNEKHYYNGDYPLLLAIQNSNNTIVKLLIDYANQHQLILELNEKDYDSGLCPLLLAFDKNNVEIAKVLIDYAGEHQISLDYDRKYKKFYKNNSEIIKLFELLEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.14
4 0.1
5 0.09
6 0.09
7 0.09
8 0.11
9 0.15
10 0.18
11 0.24
12 0.23
13 0.23
14 0.22
15 0.22
16 0.22
17 0.19
18 0.17
19 0.11
20 0.11
21 0.12
22 0.13
23 0.14
24 0.12
25 0.11
26 0.09
27 0.08
28 0.09
29 0.09
30 0.08
31 0.07
32 0.09
33 0.09
34 0.12
35 0.17
36 0.16
37 0.15
38 0.18
39 0.18
40 0.17
41 0.17
42 0.16
43 0.16
44 0.16
45 0.16
46 0.15
47 0.15
48 0.18
49 0.21
50 0.26
51 0.22
52 0.22
53 0.21
54 0.21
55 0.21
56 0.19
57 0.17
58 0.11
59 0.11
60 0.12
61 0.12
62 0.11
63 0.11
64 0.13
65 0.12
66 0.15
67 0.19
68 0.2
69 0.21
70 0.26
71 0.25
72 0.23
73 0.23
74 0.2
75 0.22
76 0.21
77 0.21
78 0.17
79 0.17
80 0.17
81 0.16
82 0.14
83 0.08
84 0.06
85 0.05
86 0.04
87 0.04
88 0.04
89 0.05
90 0.06
91 0.06
92 0.06
93 0.05
94 0.05
95 0.06
96 0.07
97 0.09
98 0.08
99 0.09
100 0.11
101 0.12
102 0.12
103 0.12
104 0.13
105 0.11
106 0.13
107 0.13
108 0.11
109 0.11
110 0.11
111 0.1
112 0.08
113 0.07
114 0.06
115 0.08
116 0.08
117 0.09
118 0.1
119 0.11
120 0.11
121 0.11
122 0.1
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.1
129 0.12
130 0.17
131 0.17
132 0.16
133 0.15
134 0.14
135 0.15
136 0.14
137 0.14
138 0.09
139 0.1
140 0.11
141 0.11
142 0.11
143 0.11
144 0.1
145 0.09
146 0.1
147 0.1
148 0.09
149 0.09
150 0.09
151 0.1
152 0.1
153 0.1
154 0.09
155 0.14
156 0.15
157 0.15
158 0.18
159 0.17
160 0.16
161 0.16
162 0.16
163 0.12
164 0.11
165 0.1
166 0.08
167 0.08
168 0.08
169 0.1
170 0.13
171 0.12
172 0.12
173 0.12
174 0.13
175 0.14
176 0.17
177 0.2
178 0.18
179 0.25
180 0.32
181 0.35
182 0.4
183 0.48
184 0.56
185 0.6
186 0.69
187 0.73
188 0.75
189 0.83
190 0.82
191 0.8
192 0.7
193 0.66
194 0.58
195 0.48