Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MM62

Protein Details
Accession A0A1Y3MM62    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MSLKRNKNNKVKKSKEILQKRKHVSKNINPNSHydrophilic
NLS Segment(s)
PositionSequence
5-23RNKNNKVKKSKEILQKRKH
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MSLKRNKNNKVKKSKEILQKRKHVSKNINPNSTSNKNIKILSKIGGMFKGNIKNQLVSSGESNMLSSGKSFILKYYFFSVKILNDKSSRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.85
4 0.85
5 0.83
6 0.85
7 0.84
8 0.85
9 0.83
10 0.81
11 0.8
12 0.79
13 0.8
14 0.8
15 0.76
16 0.68
17 0.64
18 0.63
19 0.57
20 0.52
21 0.44
22 0.39
23 0.36
24 0.37
25 0.36
26 0.31
27 0.29
28 0.26
29 0.25
30 0.22
31 0.2
32 0.19
33 0.18
34 0.15
35 0.17
36 0.21
37 0.2
38 0.23
39 0.23
40 0.22
41 0.22
42 0.24
43 0.22
44 0.17
45 0.17
46 0.15
47 0.15
48 0.14
49 0.14
50 0.11
51 0.1
52 0.09
53 0.08
54 0.08
55 0.08
56 0.1
57 0.1
58 0.11
59 0.15
60 0.16
61 0.18
62 0.23
63 0.24
64 0.24
65 0.25
66 0.26
67 0.27
68 0.34
69 0.35
70 0.34
71 0.34