Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NCX6

Protein Details
Accession A0A1Y3NCX6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
109-129KKDVLAKKTKVKKHNYPPIRSBasic
NLS Segment(s)
PositionSequence
115-118KKTK
Subcellular Location(s) nucl 11, mito 5.5, cyto_mito 4.5, plas 3, cyto 2.5, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007881  UNC-50  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF05216  UNC-50  
Amino Acid Sequences MYRYFANKFLKHSQVHAVEQNVEWAYAFDVHCNSFFPLYLITYVLHFFLLPILKMDNWFSLFIGNSMYLAAWVYYFYITFLGFHAIRRNAEELSSYLKDLNSWTSEIKKKDVLAKKTKVKKHNYPPIRSTGVIDSNSPPSSRPTSPLPQEKTTTETKNEVKKERIKSYDYRSWDKYNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.49
4 0.44
5 0.38
6 0.36
7 0.37
8 0.28
9 0.23
10 0.19
11 0.14
12 0.13
13 0.15
14 0.14
15 0.12
16 0.13
17 0.15
18 0.15
19 0.16
20 0.16
21 0.13
22 0.13
23 0.12
24 0.12
25 0.12
26 0.12
27 0.11
28 0.1
29 0.1
30 0.11
31 0.1
32 0.09
33 0.07
34 0.07
35 0.08
36 0.09
37 0.08
38 0.09
39 0.1
40 0.1
41 0.11
42 0.12
43 0.12
44 0.12
45 0.12
46 0.12
47 0.12
48 0.11
49 0.11
50 0.1
51 0.08
52 0.07
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.05
68 0.08
69 0.08
70 0.09
71 0.14
72 0.14
73 0.15
74 0.16
75 0.17
76 0.14
77 0.14
78 0.14
79 0.1
80 0.14
81 0.14
82 0.13
83 0.12
84 0.12
85 0.12
86 0.12
87 0.14
88 0.1
89 0.11
90 0.12
91 0.16
92 0.22
93 0.23
94 0.25
95 0.25
96 0.26
97 0.34
98 0.41
99 0.44
100 0.48
101 0.55
102 0.61
103 0.68
104 0.74
105 0.74
106 0.75
107 0.77
108 0.78
109 0.81
110 0.8
111 0.79
112 0.75
113 0.73
114 0.68
115 0.58
116 0.49
117 0.43
118 0.39
119 0.33
120 0.31
121 0.27
122 0.27
123 0.28
124 0.26
125 0.21
126 0.21
127 0.26
128 0.25
129 0.27
130 0.29
131 0.36
132 0.44
133 0.53
134 0.55
135 0.53
136 0.56
137 0.54
138 0.51
139 0.5
140 0.46
141 0.41
142 0.42
143 0.45
144 0.5
145 0.56
146 0.58
147 0.6
148 0.64
149 0.69
150 0.71
151 0.7
152 0.67
153 0.68
154 0.7
155 0.7
156 0.69
157 0.67
158 0.64