Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NJ03

Protein Details
Accession A0A1Y3NJ03   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-45YCSLVCYKKHKEVPCKKQETTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007529  Znf_HIT  
Pfam View protein in Pfam  
PF04438  zf-HIT  
PROSITE View protein in PROSITE  
PS51083  ZF_HIT  
Amino Acid Sequences MNKKICKICEENESKYKCPTCLTPYCSLVCYKKHKEVPCKKQETTPVKIELEKKEEKKEEEDDEEYLTKVPEEKLKQLGQSKEIRDLLQYEQLQKLLKEIDASSKPEQLYDQAFQNMSLFKEFVDKSLAIIDDDEENKNNNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.58
4 0.49
5 0.45
6 0.44
7 0.43
8 0.46
9 0.49
10 0.47
11 0.48
12 0.48
13 0.46
14 0.45
15 0.41
16 0.4
17 0.44
18 0.44
19 0.5
20 0.56
21 0.63
22 0.69
23 0.75
24 0.79
25 0.8
26 0.81
27 0.73
28 0.71
29 0.74
30 0.69
31 0.64
32 0.59
33 0.53
34 0.46
35 0.49
36 0.48
37 0.43
38 0.42
39 0.44
40 0.42
41 0.44
42 0.46
43 0.44
44 0.43
45 0.43
46 0.4
47 0.37
48 0.35
49 0.28
50 0.26
51 0.24
52 0.2
53 0.17
54 0.13
55 0.09
56 0.08
57 0.08
58 0.12
59 0.14
60 0.16
61 0.2
62 0.22
63 0.26
64 0.3
65 0.31
66 0.31
67 0.35
68 0.34
69 0.35
70 0.35
71 0.31
72 0.26
73 0.27
74 0.23
75 0.25
76 0.25
77 0.21
78 0.21
79 0.22
80 0.23
81 0.2
82 0.2
83 0.14
84 0.13
85 0.13
86 0.12
87 0.18
88 0.2
89 0.25
90 0.25
91 0.28
92 0.28
93 0.27
94 0.27
95 0.23
96 0.24
97 0.21
98 0.22
99 0.21
100 0.21
101 0.21
102 0.22
103 0.2
104 0.17
105 0.17
106 0.14
107 0.11
108 0.18
109 0.18
110 0.17
111 0.2
112 0.19
113 0.18
114 0.22
115 0.22
116 0.16
117 0.16
118 0.16
119 0.16
120 0.18
121 0.2
122 0.18