Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NHC8

Protein Details
Accession A0A1Y3NHC8   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
108-133SAILKSKKPAKAIKKREQKGVRKVRAHydrophilic
NLS Segment(s)
PositionSequence
101-133KAAAARVSAILKSKKPAKAIKKREQKGVRKVRA
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSADLVWQIVKNNNAFLVKKNGVQFSSEPGNIMNLNSFKYSGLANNKSIAISATEKGVSVSTTKAANKNLKAITVELKKGARPSAAAVKNILKGYRPDLSKAAAARVSAILKSKKPAKAIKKREQKGVRKVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.33
5 0.31
6 0.34
7 0.37
8 0.37
9 0.34
10 0.36
11 0.33
12 0.29
13 0.32
14 0.28
15 0.24
16 0.21
17 0.22
18 0.19
19 0.19
20 0.17
21 0.12
22 0.14
23 0.14
24 0.14
25 0.12
26 0.13
27 0.13
28 0.15
29 0.22
30 0.24
31 0.24
32 0.25
33 0.25
34 0.24
35 0.24
36 0.19
37 0.13
38 0.12
39 0.11
40 0.11
41 0.1
42 0.1
43 0.11
44 0.1
45 0.08
46 0.07
47 0.07
48 0.07
49 0.1
50 0.11
51 0.14
52 0.19
53 0.24
54 0.24
55 0.28
56 0.27
57 0.26
58 0.25
59 0.24
60 0.25
61 0.23
62 0.23
63 0.21
64 0.21
65 0.22
66 0.22
67 0.23
68 0.16
69 0.14
70 0.16
71 0.23
72 0.25
73 0.25
74 0.25
75 0.27
76 0.3
77 0.31
78 0.28
79 0.2
80 0.19
81 0.22
82 0.26
83 0.25
84 0.24
85 0.24
86 0.26
87 0.28
88 0.27
89 0.26
90 0.22
91 0.2
92 0.19
93 0.19
94 0.19
95 0.17
96 0.22
97 0.23
98 0.24
99 0.31
100 0.37
101 0.39
102 0.46
103 0.54
104 0.59
105 0.66
106 0.74
107 0.78
108 0.82
109 0.83
110 0.86
111 0.87
112 0.86
113 0.86