Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MZH1

Protein Details
Accession A0A1Y3MZH1   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
151-176IFTVKFQAQNRKKKKVKVAEKPLYSQHydrophilic
NLS Segment(s)
PositionSequence
161-167RKKKKVK
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences LKGWINVESADDLTGPIFILSNATEKLSCICSDSKSSKITLNSVVDSDDSNNVNIKDVTPTDVSQVFVIKRVIDSSSFNLKSAYNKYIGCDKFGVVSCENEAVGVQEEWEIIFREDGIAFKNSYEKFLTVDEQDGKMVIRADSDTIGFHEIFTVKFQAQNRKKKKVKVAEKPLYSQEIDSVKRYQSWGNGRLVMPNQDLRDLRKAKKSGKMHEAMLDRREKLKSDSYCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.06
4 0.06
5 0.05
6 0.07
7 0.07
8 0.1
9 0.11
10 0.12
11 0.12
12 0.13
13 0.15
14 0.16
15 0.15
16 0.16
17 0.17
18 0.18
19 0.25
20 0.29
21 0.31
22 0.31
23 0.32
24 0.34
25 0.35
26 0.35
27 0.35
28 0.34
29 0.3
30 0.29
31 0.28
32 0.23
33 0.21
34 0.2
35 0.17
36 0.14
37 0.14
38 0.16
39 0.16
40 0.17
41 0.16
42 0.15
43 0.15
44 0.15
45 0.17
46 0.16
47 0.17
48 0.17
49 0.18
50 0.18
51 0.15
52 0.18
53 0.15
54 0.16
55 0.16
56 0.13
57 0.13
58 0.13
59 0.14
60 0.12
61 0.15
62 0.16
63 0.24
64 0.25
65 0.24
66 0.24
67 0.24
68 0.27
69 0.29
70 0.27
71 0.21
72 0.21
73 0.22
74 0.3
75 0.29
76 0.27
77 0.24
78 0.21
79 0.22
80 0.23
81 0.25
82 0.16
83 0.17
84 0.15
85 0.15
86 0.14
87 0.1
88 0.09
89 0.06
90 0.07
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.06
97 0.06
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.07
105 0.07
106 0.07
107 0.07
108 0.13
109 0.13
110 0.15
111 0.15
112 0.14
113 0.14
114 0.15
115 0.17
116 0.12
117 0.15
118 0.14
119 0.14
120 0.13
121 0.12
122 0.11
123 0.11
124 0.11
125 0.08
126 0.07
127 0.07
128 0.08
129 0.08
130 0.09
131 0.07
132 0.08
133 0.1
134 0.09
135 0.08
136 0.09
137 0.09
138 0.09
139 0.1
140 0.11
141 0.1
142 0.14
143 0.18
144 0.28
145 0.37
146 0.47
147 0.55
148 0.64
149 0.7
150 0.74
151 0.81
152 0.8
153 0.82
154 0.82
155 0.85
156 0.83
157 0.8
158 0.76
159 0.69
160 0.62
161 0.51
162 0.4
163 0.34
164 0.31
165 0.29
166 0.29
167 0.28
168 0.25
169 0.27
170 0.28
171 0.26
172 0.28
173 0.35
174 0.37
175 0.38
176 0.42
177 0.4
178 0.43
179 0.43
180 0.39
181 0.34
182 0.33
183 0.3
184 0.32
185 0.33
186 0.33
187 0.41
188 0.43
189 0.45
190 0.5
191 0.56
192 0.57
193 0.66
194 0.7
195 0.69
196 0.72
197 0.71
198 0.64
199 0.65
200 0.65
201 0.6
202 0.58
203 0.55
204 0.48
205 0.48
206 0.48
207 0.44
208 0.42
209 0.46