Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NCM5

Protein Details
Accession A0A1Y3NCM5    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-46MRNVLDRKRHYKKDDTKGLPBasic
99-118ASQSGIKKSYKGKKGKKRRNBasic
NLS Segment(s)
PositionSequence
103-118GIKKSYKGKKGKKRRN
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences TTGKKWFDMPAPEITPEIKLDLQLIKMRNVLDRKRHYKKDDTKGLPKYFQVGTIVEDKSEYFSSRLAKKERKNTLLDEIMSDVSSRQYFKRKFNEIQKASQSGIKKSYKGKKGKKRRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.23
4 0.23
5 0.15
6 0.13
7 0.15
8 0.15
9 0.18
10 0.21
11 0.22
12 0.21
13 0.23
14 0.23
15 0.27
16 0.33
17 0.36
18 0.41
19 0.49
20 0.57
21 0.64
22 0.72
23 0.72
24 0.75
25 0.79
26 0.79
27 0.8
28 0.77
29 0.77
30 0.77
31 0.74
32 0.66
33 0.56
34 0.49
35 0.39
36 0.33
37 0.25
38 0.17
39 0.16
40 0.18
41 0.17
42 0.13
43 0.13
44 0.12
45 0.12
46 0.12
47 0.12
48 0.08
49 0.1
50 0.14
51 0.18
52 0.23
53 0.28
54 0.36
55 0.42
56 0.51
57 0.57
58 0.58
59 0.58
60 0.56
61 0.55
62 0.51
63 0.44
64 0.35
65 0.29
66 0.24
67 0.21
68 0.18
69 0.11
70 0.1
71 0.11
72 0.11
73 0.13
74 0.23
75 0.28
76 0.37
77 0.45
78 0.51
79 0.58
80 0.67
81 0.75
82 0.7
83 0.72
84 0.7
85 0.64
86 0.58
87 0.54
88 0.47
89 0.41
90 0.45
91 0.41
92 0.4
93 0.47
94 0.55
95 0.6
96 0.67
97 0.74
98 0.76