Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N6Q7

Protein Details
Accession A0A1Y3N6Q7    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
340-363DQIRRTLTIKREKMNRNHNDRSGNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR007751  DUF676_lipase-like  
IPR044294  Lipase-like  
Pfam View protein in Pfam  
PF05057  DUF676  
Amino Acid Sequences MRKLNVLFVYFIHGLGGENIDFINVKVKLEETFDKLFKDDETYSDVKNIIRTYCANSNSGMESTFPLEVMFENNFKEYTKYFENNLIRSLNREKDKYSDFKDVECNIYISIIGHSLGGNVARGTITKLFKPYLKNIITYENFFEYIKKRYTFITNIIPCSYLSLSSPHLGSLISEPNETTKLIKRIEKKIVKTFCNVVIGDIGKELTFQDEKVKAKTNKTSEENVIIDNSKYALINCCSKESMEALARFPNRTLTAFLRYDLQVKYCSAMGCIETPLPSIIKNEKDILINRKNDARIVMYSGYNEGSELEYYQRELFNEKVSKNFYYKNTKIAPSPDIDDQIRRTLTIKREKMNRNHNDRSGNAPSNNESPEGTETPEEYGKYYLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.09
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.16
11 0.14
12 0.15
13 0.15
14 0.16
15 0.17
16 0.23
17 0.26
18 0.24
19 0.3
20 0.31
21 0.32
22 0.32
23 0.31
24 0.27
25 0.28
26 0.24
27 0.2
28 0.25
29 0.26
30 0.25
31 0.27
32 0.28
33 0.23
34 0.27
35 0.27
36 0.21
37 0.23
38 0.24
39 0.28
40 0.33
41 0.35
42 0.31
43 0.3
44 0.31
45 0.3
46 0.28
47 0.22
48 0.16
49 0.15
50 0.16
51 0.15
52 0.13
53 0.1
54 0.1
55 0.1
56 0.12
57 0.13
58 0.12
59 0.13
60 0.14
61 0.15
62 0.15
63 0.17
64 0.15
65 0.19
66 0.24
67 0.25
68 0.26
69 0.35
70 0.4
71 0.39
72 0.42
73 0.39
74 0.32
75 0.35
76 0.4
77 0.39
78 0.39
79 0.4
80 0.38
81 0.41
82 0.47
83 0.48
84 0.47
85 0.49
86 0.44
87 0.44
88 0.49
89 0.45
90 0.42
91 0.36
92 0.31
93 0.21
94 0.21
95 0.18
96 0.12
97 0.1
98 0.08
99 0.07
100 0.06
101 0.06
102 0.06
103 0.07
104 0.06
105 0.06
106 0.05
107 0.06
108 0.05
109 0.06
110 0.08
111 0.13
112 0.15
113 0.16
114 0.2
115 0.21
116 0.25
117 0.29
118 0.32
119 0.35
120 0.35
121 0.35
122 0.34
123 0.4
124 0.37
125 0.35
126 0.32
127 0.24
128 0.23
129 0.21
130 0.23
131 0.18
132 0.21
133 0.24
134 0.23
135 0.22
136 0.24
137 0.29
138 0.29
139 0.3
140 0.35
141 0.33
142 0.34
143 0.34
144 0.32
145 0.27
146 0.26
147 0.22
148 0.13
149 0.11
150 0.11
151 0.12
152 0.12
153 0.13
154 0.1
155 0.1
156 0.09
157 0.09
158 0.09
159 0.12
160 0.11
161 0.11
162 0.11
163 0.12
164 0.13
165 0.13
166 0.13
167 0.14
168 0.18
169 0.21
170 0.27
171 0.31
172 0.38
173 0.48
174 0.52
175 0.52
176 0.56
177 0.59
178 0.56
179 0.52
180 0.47
181 0.39
182 0.37
183 0.31
184 0.23
185 0.19
186 0.17
187 0.15
188 0.12
189 0.1
190 0.06
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.12
197 0.16
198 0.18
199 0.2
200 0.29
201 0.3
202 0.35
203 0.42
204 0.42
205 0.45
206 0.48
207 0.49
208 0.42
209 0.43
210 0.38
211 0.32
212 0.28
213 0.22
214 0.17
215 0.14
216 0.12
217 0.08
218 0.08
219 0.08
220 0.1
221 0.12
222 0.17
223 0.18
224 0.19
225 0.19
226 0.19
227 0.2
228 0.18
229 0.2
230 0.19
231 0.19
232 0.19
233 0.24
234 0.25
235 0.24
236 0.23
237 0.23
238 0.2
239 0.2
240 0.22
241 0.2
242 0.25
243 0.25
244 0.25
245 0.24
246 0.23
247 0.26
248 0.23
249 0.22
250 0.17
251 0.17
252 0.18
253 0.17
254 0.16
255 0.13
256 0.13
257 0.13
258 0.12
259 0.13
260 0.12
261 0.1
262 0.11
263 0.11
264 0.11
265 0.1
266 0.13
267 0.17
268 0.19
269 0.21
270 0.23
271 0.24
272 0.27
273 0.32
274 0.38
275 0.4
276 0.41
277 0.41
278 0.44
279 0.43
280 0.41
281 0.38
282 0.32
283 0.25
284 0.26
285 0.26
286 0.21
287 0.21
288 0.21
289 0.19
290 0.15
291 0.14
292 0.11
293 0.1
294 0.09
295 0.1
296 0.11
297 0.1
298 0.12
299 0.14
300 0.15
301 0.14
302 0.17
303 0.18
304 0.24
305 0.3
306 0.29
307 0.33
308 0.36
309 0.39
310 0.4
311 0.45
312 0.44
313 0.48
314 0.49
315 0.52
316 0.54
317 0.54
318 0.53
319 0.52
320 0.48
321 0.41
322 0.43
323 0.38
324 0.37
325 0.36
326 0.36
327 0.34
328 0.36
329 0.33
330 0.3
331 0.29
332 0.31
333 0.39
334 0.45
335 0.49
336 0.51
337 0.6
338 0.69
339 0.77
340 0.81
341 0.82
342 0.81
343 0.83
344 0.82
345 0.79
346 0.72
347 0.7
348 0.68
349 0.65
350 0.58
351 0.52
352 0.5
353 0.48
354 0.47
355 0.41
356 0.32
357 0.28
358 0.31
359 0.29
360 0.27
361 0.24
362 0.23
363 0.25
364 0.28
365 0.25
366 0.21