Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3ML43

Protein Details
Accession A0A1Y3ML43    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
153-172SYYRRLLSRIKNNPNINKQNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039789  CYRI  
IPR009828  CYRIA/CYRIB_Rac1-bd  
Gene Ontology GO:0016020  C:membrane  
GO:0031267  F:small GTPase binding  
GO:0030833  P:regulation of actin filament polymerization  
Pfam View protein in Pfam  
PF07159  CYRIA-B_Rac1-bd  
Amino Acid Sequences MGSIVSILQNSNESGPDIILDFENAQPIPEEEQLYRYVVEILNRSNAILQSLRQYTGCGDLIRKAISNPSPQTEEEAWVALTPSAVKLKKYYEFSQRIEDIFPRILYILCKGNITENLAKYQATTKKLADLLSFVLQFDDLKMTNPSIQNDFSYYRRLLSRIKNNPNINKQNIPVNDELANRMSLFYAYSTPMFKAVTDATLAFVASVSFSLPILDNYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.1
5 0.1
6 0.09
7 0.1
8 0.1
9 0.1
10 0.13
11 0.12
12 0.12
13 0.12
14 0.13
15 0.15
16 0.17
17 0.19
18 0.16
19 0.18
20 0.2
21 0.2
22 0.19
23 0.15
24 0.15
25 0.14
26 0.16
27 0.17
28 0.17
29 0.2
30 0.2
31 0.19
32 0.19
33 0.18
34 0.18
35 0.16
36 0.15
37 0.18
38 0.19
39 0.2
40 0.18
41 0.19
42 0.17
43 0.2
44 0.21
45 0.16
46 0.15
47 0.17
48 0.19
49 0.2
50 0.19
51 0.15
52 0.19
53 0.22
54 0.28
55 0.27
56 0.28
57 0.3
58 0.29
59 0.34
60 0.29
61 0.28
62 0.21
63 0.2
64 0.16
65 0.13
66 0.13
67 0.08
68 0.07
69 0.05
70 0.06
71 0.11
72 0.12
73 0.12
74 0.14
75 0.18
76 0.23
77 0.28
78 0.31
79 0.36
80 0.41
81 0.43
82 0.45
83 0.43
84 0.39
85 0.35
86 0.31
87 0.24
88 0.19
89 0.16
90 0.11
91 0.1
92 0.1
93 0.09
94 0.11
95 0.11
96 0.1
97 0.11
98 0.11
99 0.12
100 0.13
101 0.17
102 0.18
103 0.16
104 0.17
105 0.17
106 0.17
107 0.16
108 0.21
109 0.22
110 0.21
111 0.23
112 0.22
113 0.25
114 0.26
115 0.27
116 0.21
117 0.17
118 0.16
119 0.16
120 0.16
121 0.12
122 0.11
123 0.1
124 0.1
125 0.09
126 0.08
127 0.06
128 0.08
129 0.09
130 0.1
131 0.14
132 0.16
133 0.18
134 0.18
135 0.19
136 0.19
137 0.21
138 0.23
139 0.2
140 0.23
141 0.21
142 0.21
143 0.22
144 0.24
145 0.27
146 0.34
147 0.43
148 0.49
149 0.58
150 0.64
151 0.71
152 0.77
153 0.81
154 0.79
155 0.74
156 0.68
157 0.61
158 0.6
159 0.54
160 0.5
161 0.41
162 0.35
163 0.33
164 0.29
165 0.3
166 0.23
167 0.22
168 0.17
169 0.16
170 0.14
171 0.11
172 0.11
173 0.1
174 0.1
175 0.11
176 0.13
177 0.14
178 0.14
179 0.16
180 0.16
181 0.14
182 0.16
183 0.15
184 0.15
185 0.15
186 0.15
187 0.14
188 0.14
189 0.14
190 0.1
191 0.09
192 0.08
193 0.06
194 0.06
195 0.05
196 0.06
197 0.06
198 0.07
199 0.08