Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MX73

Protein Details
Accession A0A1Y3MX73    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-37SDCPVEKKKKIIKCLKCKTKPYEINIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
Amino Acid Sequences MEQKNCQCTPSSDCPVEKKKKIIKCLKCKTKPYEINIRENYPLCKTNVGQARKIKKGTKVLIALSGGDCSRALLDIFYQYHKGAENPKSGKIQRFSEIAVAYVDDSIITGQVCFFILLNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.61
3 0.67
4 0.64
5 0.64
6 0.65
7 0.68
8 0.75
9 0.77
10 0.78
11 0.79
12 0.85
13 0.87
14 0.87
15 0.88
16 0.84
17 0.85
18 0.82
19 0.77
20 0.77
21 0.71
22 0.72
23 0.67
24 0.63
25 0.55
26 0.49
27 0.45
28 0.38
29 0.35
30 0.26
31 0.25
32 0.23
33 0.26
34 0.32
35 0.33
36 0.35
37 0.4
38 0.46
39 0.48
40 0.53
41 0.5
42 0.48
43 0.53
44 0.49
45 0.47
46 0.43
47 0.38
48 0.35
49 0.32
50 0.26
51 0.18
52 0.16
53 0.1
54 0.08
55 0.07
56 0.06
57 0.05
58 0.05
59 0.05
60 0.04
61 0.05
62 0.08
63 0.09
64 0.1
65 0.12
66 0.12
67 0.12
68 0.13
69 0.15
70 0.19
71 0.23
72 0.3
73 0.31
74 0.35
75 0.42
76 0.45
77 0.5
78 0.48
79 0.47
80 0.42
81 0.41
82 0.38
83 0.36
84 0.32
85 0.26
86 0.21
87 0.17
88 0.14
89 0.12
90 0.11
91 0.06
92 0.06
93 0.05
94 0.06
95 0.05
96 0.05
97 0.05
98 0.06
99 0.07
100 0.07