Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NL49

Protein Details
Accession A0A1Y3NL49    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
41-61WLCNADKKYHNPKKRLTRFFSHydrophilic
147-204VDYAYERIKERRRRSKKNRAPVKDRNWVLHKKEVARKKGKTNVPKDSKYTGRKRRVRFBasic
NLS Segment(s)
PositionSequence
154-204IKERRRRSKKNRAPVKDRNWVLHKKEVARKKGKTNVPKDSKYTGRKRRVRF
Subcellular Location(s) cyto_nucl 11.5, cyto 11, nucl 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039769  Bud23-like  
IPR022238  Bud23_C  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0016435  F:rRNA (guanine) methyltransferase activity  
GO:0070476  P:rRNA (guanine-N7)-methylation  
Pfam View protein in Pfam  
PF12589  WBS_methylT  
Amino Acid Sequences FLEVARERDIQGDMFLQDIGDGFGFRPGTFDGAISISVIQWLCNADKKYHNPKKRLTRFFSTLYSALARGARAVFQFYPENPDQVELIVGSAMKCGFTGGLVVDYPNSSKAKKFYLCLFAGFADDPNNSPSLPKGLGTEGDEPRNSVDYAYERIKERRRRSKKNRAPVKDRNWVLHKKEVARKKGKTNVPKDSKYTGRKRRVRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.09
5 0.09
6 0.08
7 0.06
8 0.06
9 0.06
10 0.1
11 0.1
12 0.1
13 0.12
14 0.12
15 0.14
16 0.14
17 0.13
18 0.11
19 0.11
20 0.12
21 0.1
22 0.1
23 0.07
24 0.1
25 0.09
26 0.08
27 0.08
28 0.1
29 0.11
30 0.17
31 0.19
32 0.21
33 0.28
34 0.37
35 0.48
36 0.56
37 0.63
38 0.64
39 0.72
40 0.8
41 0.83
42 0.84
43 0.79
44 0.77
45 0.73
46 0.7
47 0.63
48 0.56
49 0.46
50 0.38
51 0.32
52 0.24
53 0.2
54 0.17
55 0.14
56 0.11
57 0.1
58 0.1
59 0.1
60 0.12
61 0.11
62 0.13
63 0.15
64 0.14
65 0.2
66 0.19
67 0.2
68 0.17
69 0.17
70 0.14
71 0.13
72 0.13
73 0.06
74 0.05
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.03
85 0.04
86 0.03
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.08
94 0.09
95 0.09
96 0.11
97 0.13
98 0.19
99 0.2
100 0.22
101 0.24
102 0.29
103 0.29
104 0.29
105 0.27
106 0.21
107 0.21
108 0.19
109 0.15
110 0.1
111 0.1
112 0.1
113 0.1
114 0.1
115 0.09
116 0.09
117 0.09
118 0.11
119 0.11
120 0.1
121 0.11
122 0.11
123 0.13
124 0.16
125 0.22
126 0.21
127 0.24
128 0.24
129 0.23
130 0.23
131 0.23
132 0.2
133 0.14
134 0.13
135 0.13
136 0.17
137 0.2
138 0.22
139 0.23
140 0.31
141 0.4
142 0.48
143 0.56
144 0.63
145 0.71
146 0.79
147 0.87
148 0.91
149 0.92
150 0.93
151 0.94
152 0.92
153 0.92
154 0.91
155 0.89
156 0.87
157 0.8
158 0.77
159 0.74
160 0.73
161 0.68
162 0.66
163 0.63
164 0.62
165 0.68
166 0.69
167 0.71
168 0.72
169 0.73
170 0.75
171 0.78
172 0.79
173 0.81
174 0.81
175 0.82
176 0.82
177 0.81
178 0.76
179 0.75
180 0.75
181 0.75
182 0.76
183 0.76
184 0.77