Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NHD8

Protein Details
Accession A0A1Y3NHD8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKISSNKRKYKNKKYALALLKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 11, vacu 2
Family & Domain DBs
Amino Acid Sequences MKISSNKRKYKNKKYALALLKTFVEYLLTTDHHWPETIGITVLKKDAVFVRNGIYDNLPDLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.82
4 0.77
5 0.67
6 0.58
7 0.49
8 0.4
9 0.33
10 0.23
11 0.16
12 0.1
13 0.09
14 0.09
15 0.09
16 0.1
17 0.13
18 0.13
19 0.12
20 0.12
21 0.11
22 0.1
23 0.11
24 0.1
25 0.08
26 0.09
27 0.09
28 0.09
29 0.1
30 0.1
31 0.08
32 0.1
33 0.14
34 0.15
35 0.16
36 0.16
37 0.19
38 0.21
39 0.22
40 0.22
41 0.19
42 0.18
43 0.19