Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N0S7

Protein Details
Accession A0A1Y3N0S7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
197-221FLESYHKKHFKKKGRRASQINSKIEHydrophilic
NLS Segment(s)
PositionSequence
203-214KKHFKKKGRRAS
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020529  ORC6_met/pln  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0006260  P:DNA replication  
Amino Acid Sequences MYLNETVQPETDLLFKRLNIDVSKKTRELAGEYFRRIQSQLPKTNCVGLIEVACCEIACETNRNEFIPFERKQGVKLAGGIMKDYQKLYVIIKNTLNISIPEVTPESLGNYFGSTFIIPAVKQLLHEFKKNYGEILSEQDKKNMKWESVEFVSAAFYLIMYNTGITIDKNKIISIAKITTKRFKDIQSLMTQYCDSFLESYHKKHFKKKGRRASQINSKIEGQDNKRRKSIGSFENNIINKTPIKNKEIIDSTTDIIKSEGDIEVLKSSEDNDSVILIENNKLSDKDAGLIPKKRKYINGINSAVTNVDFYNSKKWRDYCEWKSVILKGLKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.26
4 0.29
5 0.33
6 0.31
7 0.35
8 0.41
9 0.46
10 0.53
11 0.5
12 0.47
13 0.46
14 0.43
15 0.42
16 0.4
17 0.42
18 0.42
19 0.46
20 0.51
21 0.49
22 0.48
23 0.44
24 0.42
25 0.43
26 0.46
27 0.51
28 0.5
29 0.54
30 0.53
31 0.57
32 0.52
33 0.43
34 0.34
35 0.27
36 0.25
37 0.21
38 0.19
39 0.15
40 0.13
41 0.11
42 0.1
43 0.08
44 0.09
45 0.1
46 0.14
47 0.16
48 0.23
49 0.25
50 0.26
51 0.26
52 0.24
53 0.28
54 0.31
55 0.3
56 0.29
57 0.33
58 0.33
59 0.33
60 0.39
61 0.37
62 0.3
63 0.3
64 0.29
65 0.26
66 0.26
67 0.25
68 0.21
69 0.2
70 0.2
71 0.19
72 0.15
73 0.14
74 0.16
75 0.17
76 0.19
77 0.19
78 0.22
79 0.23
80 0.24
81 0.23
82 0.23
83 0.21
84 0.17
85 0.18
86 0.15
87 0.14
88 0.14
89 0.14
90 0.13
91 0.13
92 0.12
93 0.11
94 0.1
95 0.11
96 0.09
97 0.09
98 0.09
99 0.08
100 0.09
101 0.07
102 0.06
103 0.07
104 0.07
105 0.07
106 0.07
107 0.1
108 0.09
109 0.09
110 0.12
111 0.2
112 0.21
113 0.26
114 0.27
115 0.28
116 0.33
117 0.33
118 0.31
119 0.23
120 0.22
121 0.19
122 0.23
123 0.24
124 0.24
125 0.24
126 0.29
127 0.31
128 0.3
129 0.35
130 0.32
131 0.27
132 0.26
133 0.27
134 0.26
135 0.25
136 0.25
137 0.18
138 0.16
139 0.15
140 0.12
141 0.11
142 0.06
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.03
150 0.04
151 0.04
152 0.04
153 0.07
154 0.08
155 0.09
156 0.1
157 0.1
158 0.12
159 0.12
160 0.13
161 0.13
162 0.15
163 0.18
164 0.23
165 0.26
166 0.31
167 0.32
168 0.35
169 0.35
170 0.34
171 0.37
172 0.35
173 0.37
174 0.34
175 0.36
176 0.33
177 0.31
178 0.29
179 0.21
180 0.19
181 0.15
182 0.11
183 0.08
184 0.08
185 0.14
186 0.16
187 0.2
188 0.28
189 0.36
190 0.38
191 0.47
192 0.56
193 0.61
194 0.7
195 0.77
196 0.79
197 0.81
198 0.88
199 0.87
200 0.86
201 0.86
202 0.85
203 0.78
204 0.69
205 0.6
206 0.52
207 0.48
208 0.46
209 0.41
210 0.42
211 0.47
212 0.48
213 0.5
214 0.49
215 0.45
216 0.46
217 0.48
218 0.47
219 0.47
220 0.47
221 0.46
222 0.53
223 0.53
224 0.47
225 0.39
226 0.32
227 0.26
228 0.26
229 0.32
230 0.3
231 0.33
232 0.37
233 0.37
234 0.42
235 0.43
236 0.41
237 0.37
238 0.33
239 0.3
240 0.28
241 0.27
242 0.21
243 0.17
244 0.15
245 0.12
246 0.11
247 0.11
248 0.08
249 0.09
250 0.09
251 0.1
252 0.1
253 0.1
254 0.09
255 0.1
256 0.11
257 0.11
258 0.1
259 0.09
260 0.09
261 0.1
262 0.11
263 0.11
264 0.1
265 0.11
266 0.12
267 0.13
268 0.14
269 0.14
270 0.14
271 0.16
272 0.16
273 0.16
274 0.19
275 0.25
276 0.32
277 0.39
278 0.45
279 0.5
280 0.55
281 0.56
282 0.58
283 0.59
284 0.63
285 0.65
286 0.67
287 0.63
288 0.59
289 0.56
290 0.51
291 0.43
292 0.32
293 0.23
294 0.13
295 0.12
296 0.12
297 0.14
298 0.24
299 0.28
300 0.33
301 0.39
302 0.43
303 0.49
304 0.57
305 0.66
306 0.63
307 0.69
308 0.67
309 0.63
310 0.64
311 0.59
312 0.57