Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N0J1

Protein Details
Accession A0A1Y3N0J1   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
165-193YQLEQERWKKSKRRLSRKIQLNEDKSKRTHydrophilic
NLS Segment(s)
PositionSequence
172-182WKKSKRRLSRK
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MDFLKSEKFTQVTDIEQMIKEVIELKKVVSDNRLDQLKHEHLEDIKKREPAQREMEQLRETLKLLRKENKEQANKINEDKKIQQALTDEIVLLKQLVKELQEDNEAVKMQVKDLRTILSQEEKIKGDDRLISLQEELQFLKDKLRATQVELCQSRMQYNELETAYQLEQERWKKSKRRLSRKIQLNEDKSKRTSYMIEPPSTPATPTSMKPIELPSIHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.23
4 0.23
5 0.19
6 0.16
7 0.14
8 0.17
9 0.15
10 0.16
11 0.16
12 0.16
13 0.21
14 0.23
15 0.25
16 0.23
17 0.27
18 0.28
19 0.34
20 0.39
21 0.33
22 0.34
23 0.4
24 0.41
25 0.38
26 0.35
27 0.31
28 0.3
29 0.4
30 0.44
31 0.43
32 0.42
33 0.45
34 0.47
35 0.51
36 0.53
37 0.51
38 0.52
39 0.5
40 0.53
41 0.52
42 0.53
43 0.47
44 0.42
45 0.37
46 0.3
47 0.25
48 0.24
49 0.27
50 0.29
51 0.34
52 0.42
53 0.46
54 0.53
55 0.61
56 0.64
57 0.65
58 0.62
59 0.65
60 0.64
61 0.61
62 0.59
63 0.57
64 0.49
65 0.46
66 0.45
67 0.43
68 0.4
69 0.36
70 0.32
71 0.28
72 0.28
73 0.25
74 0.22
75 0.16
76 0.11
77 0.11
78 0.09
79 0.08
80 0.06
81 0.05
82 0.05
83 0.06
84 0.07
85 0.08
86 0.09
87 0.1
88 0.11
89 0.11
90 0.11
91 0.12
92 0.11
93 0.09
94 0.12
95 0.11
96 0.1
97 0.13
98 0.13
99 0.14
100 0.14
101 0.15
102 0.12
103 0.14
104 0.14
105 0.15
106 0.17
107 0.17
108 0.2
109 0.19
110 0.2
111 0.21
112 0.19
113 0.17
114 0.17
115 0.17
116 0.16
117 0.16
118 0.15
119 0.14
120 0.15
121 0.15
122 0.14
123 0.12
124 0.11
125 0.13
126 0.12
127 0.16
128 0.17
129 0.16
130 0.17
131 0.24
132 0.23
133 0.26
134 0.33
135 0.32
136 0.39
137 0.39
138 0.4
139 0.35
140 0.35
141 0.32
142 0.26
143 0.25
144 0.17
145 0.18
146 0.2
147 0.18
148 0.18
149 0.16
150 0.17
151 0.16
152 0.17
153 0.16
154 0.14
155 0.21
156 0.27
157 0.34
158 0.37
159 0.45
160 0.51
161 0.6
162 0.69
163 0.73
164 0.78
165 0.82
166 0.87
167 0.89
168 0.9
169 0.89
170 0.89
171 0.88
172 0.85
173 0.85
174 0.81
175 0.77
176 0.69
177 0.64
178 0.55
179 0.48
180 0.44
181 0.4
182 0.44
183 0.44
184 0.44
185 0.42
186 0.44
187 0.46
188 0.42
189 0.36
190 0.27
191 0.26
192 0.26
193 0.26
194 0.31
195 0.29
196 0.29
197 0.31
198 0.33
199 0.35