Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N3R0

Protein Details
Accession A0A1Y3N3R0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
50-76QRIHSKERPYQCKICKRKFARGDALVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences YPCTYPGCTKSFSRPCHRQSHERSHENSRPFVCPECKRAFCRKHDMIRHQRIHSKERPYQCKICKRKFARGDALVRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.73
4 0.76
5 0.75
6 0.75
7 0.78
8 0.78
9 0.76
10 0.74
11 0.72
12 0.72
13 0.65
14 0.61
15 0.52
16 0.44
17 0.39
18 0.39
19 0.37
20 0.34
21 0.38
22 0.4
23 0.42
24 0.44
25 0.52
26 0.54
27 0.53
28 0.59
29 0.59
30 0.61
31 0.65
32 0.71
33 0.72
34 0.75
35 0.76
36 0.71
37 0.7
38 0.66
39 0.66
40 0.63
41 0.6
42 0.58
43 0.61
44 0.65
45 0.67
46 0.71
47 0.73
48 0.76
49 0.78
50 0.8
51 0.81
52 0.8
53 0.84
54 0.84
55 0.83
56 0.83
57 0.8