Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NT34

Protein Details
Accession A0A1Y3NT34    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-44VKEEKVEKKPTNKKEVKKEEKEEABasic
77-110MEEVKEEKPKPKPKPKPKQAQKPKPKAAAKGKPABasic
117-139AAKPAGQKRKMPNKGANAKKVKTHydrophilic
NLS Segment(s)
PositionSequence
28-38KKPTNKKEVKK
82-138EEKPKPKPKPKPKQAQKPKPKAAAKGKPANTKKPAAAKPAGQKRKMPNKGANAKKVK
Subcellular Location(s) nucl 18, cyto_nucl 12.833, mito_nucl 10.333, cyto 6.5
Family & Domain DBs
Amino Acid Sequences YRVSSDVNKVENQSPDLIVEVKEEKVEKKPTNKKEVKKEEKEEAQIKQEVKKEEEDKEKDTEDDTEEEKEEVQDVKMEEVKEEKPKPKPKPKPKQAQKPKPKAAAKGKPANTKKPAAAKPAGQKRKMPNKGANAKKVKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.24
4 0.21
5 0.16
6 0.16
7 0.16
8 0.14
9 0.16
10 0.17
11 0.18
12 0.24
13 0.33
14 0.36
15 0.45
16 0.54
17 0.61
18 0.7
19 0.77
20 0.78
21 0.8
22 0.85
23 0.85
24 0.85
25 0.82
26 0.79
27 0.76
28 0.75
29 0.68
30 0.6
31 0.54
32 0.49
33 0.44
34 0.41
35 0.4
36 0.36
37 0.33
38 0.36
39 0.35
40 0.36
41 0.44
42 0.42
43 0.4
44 0.4
45 0.38
46 0.33
47 0.3
48 0.25
49 0.18
50 0.16
51 0.14
52 0.13
53 0.13
54 0.12
55 0.11
56 0.1
57 0.09
58 0.08
59 0.07
60 0.08
61 0.07
62 0.09
63 0.11
64 0.11
65 0.11
66 0.13
67 0.15
68 0.21
69 0.26
70 0.3
71 0.37
72 0.47
73 0.57
74 0.65
75 0.74
76 0.78
77 0.84
78 0.89
79 0.91
80 0.92
81 0.94
82 0.94
83 0.94
84 0.94
85 0.93
86 0.92
87 0.9
88 0.84
89 0.83
90 0.82
91 0.8
92 0.78
93 0.77
94 0.75
95 0.76
96 0.77
97 0.77
98 0.72
99 0.67
100 0.64
101 0.64
102 0.62
103 0.59
104 0.57
105 0.54
106 0.59
107 0.65
108 0.69
109 0.63
110 0.66
111 0.69
112 0.76
113 0.78
114 0.76
115 0.74
116 0.76
117 0.82
118 0.84
119 0.84
120 0.82