Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NHF4

Protein Details
Accession A0A1Y3NHF4   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-48SEGKPFDKKKEEKEEKNSQYBasic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR000156  Ran_bind_dom  
IPR045255  RanBP1-like  
Gene Ontology GO:0046907  P:intracellular transport  
Pfam View protein in Pfam  
PF00638  Ran_BP1  
PROSITE View protein in PROSITE  
PS50196  RANBD1  
Amino Acid Sequences PFGSLSSEKSSFSSIGKSTNNNTFESLLSEGKPFDKKKEEKEEKNSQYTEKDTKTGEEDEECIHSVRAKLYEDENNSWKERGIGLLKINCNKENKSKVRLVMRTEGILRVILNERIIPGMKFNVIQDKYISFAAIADSKTIKKYLIKTGTAMGANELHQALVKAIPKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.26
3 0.28
4 0.31
5 0.33
6 0.4
7 0.41
8 0.37
9 0.38
10 0.33
11 0.3
12 0.29
13 0.27
14 0.2
15 0.19
16 0.18
17 0.17
18 0.19
19 0.26
20 0.25
21 0.28
22 0.37
23 0.41
24 0.5
25 0.6
26 0.67
27 0.69
28 0.76
29 0.8
30 0.77
31 0.78
32 0.71
33 0.62
34 0.55
35 0.52
36 0.49
37 0.4
38 0.36
39 0.3
40 0.3
41 0.3
42 0.28
43 0.24
44 0.19
45 0.18
46 0.16
47 0.17
48 0.16
49 0.13
50 0.12
51 0.12
52 0.11
53 0.12
54 0.13
55 0.12
56 0.13
57 0.15
58 0.2
59 0.23
60 0.25
61 0.27
62 0.27
63 0.27
64 0.26
65 0.23
66 0.19
67 0.15
68 0.15
69 0.14
70 0.13
71 0.16
72 0.19
73 0.22
74 0.25
75 0.27
76 0.27
77 0.28
78 0.28
79 0.33
80 0.39
81 0.41
82 0.42
83 0.44
84 0.46
85 0.52
86 0.54
87 0.5
88 0.46
89 0.42
90 0.38
91 0.35
92 0.31
93 0.23
94 0.19
95 0.15
96 0.11
97 0.12
98 0.12
99 0.11
100 0.11
101 0.1
102 0.11
103 0.12
104 0.1
105 0.1
106 0.1
107 0.11
108 0.11
109 0.12
110 0.2
111 0.2
112 0.21
113 0.21
114 0.2
115 0.21
116 0.21
117 0.2
118 0.1
119 0.1
120 0.11
121 0.12
122 0.12
123 0.12
124 0.14
125 0.15
126 0.17
127 0.18
128 0.18
129 0.21
130 0.25
131 0.34
132 0.39
133 0.4
134 0.39
135 0.42
136 0.44
137 0.4
138 0.35
139 0.27
140 0.21
141 0.2
142 0.21
143 0.18
144 0.13
145 0.12
146 0.13
147 0.11
148 0.14