Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NJE7

Protein Details
Accession A0A1Y3NJE7    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-68ALLYYRKRTKDIRKELRKCNAKYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 12, cyto 10.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012341  6hp_glycosidase-like_sf  
IPR044674  EDEM1/2/3  
IPR001382  Glyco_hydro_47  
IPR036026  Seven-hairpin_glycosidases  
Gene Ontology GO:0044322  C:endoplasmic reticulum quality control compartment  
GO:0016020  C:membrane  
GO:0005509  F:calcium ion binding  
GO:0004571  F:mannosyl-oligosaccharide 1,2-alpha-mannosidase activity  
GO:0005975  P:carbohydrate metabolic process  
GO:1904380  P:endoplasmic reticulum mannose trimming  
GO:1904382  P:mannose trimming involved in glycoprotein ERAD pathway  
Pfam View protein in Pfam  
PF01532  Glyco_hydro_47  
Amino Acid Sequences MESFFLSETLKYLYLLFDPDNKYNKNYIFSTEAHPFPVVKSNKSQALLYYRKRTKDIRKELRKCNAKYDATRFFFIKEKILLVIYFMAPKPNDMGRSQYYKHYLDPLFENHPKGRDIFVDFRKGICSYQHWVEASMMGLETDMRMFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.19
5 0.23
6 0.29
7 0.35
8 0.35
9 0.37
10 0.4
11 0.42
12 0.4
13 0.36
14 0.34
15 0.32
16 0.32
17 0.34
18 0.34
19 0.32
20 0.28
21 0.28
22 0.24
23 0.21
24 0.28
25 0.26
26 0.23
27 0.28
28 0.3
29 0.34
30 0.35
31 0.34
32 0.29
33 0.35
34 0.4
35 0.42
36 0.47
37 0.48
38 0.49
39 0.52
40 0.57
41 0.59
42 0.62
43 0.67
44 0.68
45 0.75
46 0.8
47 0.85
48 0.87
49 0.85
50 0.76
51 0.73
52 0.7
53 0.63
54 0.59
55 0.57
56 0.56
57 0.49
58 0.49
59 0.41
60 0.35
61 0.35
62 0.31
63 0.26
64 0.18
65 0.15
66 0.15
67 0.15
68 0.13
69 0.1
70 0.1
71 0.08
72 0.09
73 0.08
74 0.11
75 0.1
76 0.1
77 0.12
78 0.13
79 0.15
80 0.15
81 0.2
82 0.21
83 0.26
84 0.27
85 0.3
86 0.33
87 0.33
88 0.33
89 0.35
90 0.32
91 0.29
92 0.3
93 0.29
94 0.31
95 0.33
96 0.36
97 0.31
98 0.32
99 0.31
100 0.3
101 0.28
102 0.23
103 0.26
104 0.3
105 0.33
106 0.38
107 0.37
108 0.37
109 0.38
110 0.36
111 0.31
112 0.27
113 0.27
114 0.25
115 0.29
116 0.33
117 0.31
118 0.31
119 0.31
120 0.28
121 0.24
122 0.19
123 0.15
124 0.1
125 0.09
126 0.07
127 0.07