Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NJ46

Protein Details
Accession A0A1Y3NJ46   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-90FDDIKVSKKRKRVTKDKLKKKWRNELDQAMNHydrophilic
NLS Segment(s)
PositionSequence
66-82SKKRKRVTKDKLKKKWR
Subcellular Location(s) nucl 23, cyto 2.5, cyto_pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013950  Mis14/Nsl1  
Gene Ontology GO:0000776  C:kinetochore  
GO:0000070  P:mitotic sister chromatid segregation  
Pfam View protein in Pfam  
PF08641  Mis14  
Amino Acid Sequences MSKSKDTDSMESLNTQKDSFPKISVDSRYDIDFLKNQFKQSIKKICDEMEKSNNLYPQNFDDIKVSKKRKRVTKDKLKKKWRNELDQAMNDWIEKIFEMAGPNIVIGGEEYEEVFNTKEAHEPLDANLAKTLTDLDKQISLLQIEISEQRRRYSEAIKKMTVQEINIKNKEIKKTKINDISPSIIEIDDTEVNWESVQKKYEKILKKVGELTKRENNENNNAYSSLIAKLKNVDEMILNYKEEKSNKKQKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.26
4 0.27
5 0.31
6 0.3
7 0.3
8 0.28
9 0.31
10 0.37
11 0.39
12 0.39
13 0.36
14 0.35
15 0.35
16 0.33
17 0.3
18 0.27
19 0.27
20 0.27
21 0.33
22 0.34
23 0.34
24 0.38
25 0.41
26 0.44
27 0.49
28 0.55
29 0.49
30 0.52
31 0.53
32 0.52
33 0.56
34 0.54
35 0.52
36 0.5
37 0.49
38 0.47
39 0.48
40 0.47
41 0.4
42 0.37
43 0.32
44 0.27
45 0.31
46 0.29
47 0.26
48 0.27
49 0.27
50 0.33
51 0.4
52 0.45
53 0.44
54 0.51
55 0.58
56 0.64
57 0.71
58 0.76
59 0.77
60 0.8
61 0.86
62 0.89
63 0.92
64 0.93
65 0.93
66 0.91
67 0.91
68 0.88
69 0.86
70 0.83
71 0.81
72 0.77
73 0.7
74 0.63
75 0.53
76 0.44
77 0.35
78 0.27
79 0.18
80 0.11
81 0.08
82 0.06
83 0.05
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.06
91 0.06
92 0.05
93 0.04
94 0.04
95 0.03
96 0.03
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.05
103 0.06
104 0.06
105 0.09
106 0.09
107 0.1
108 0.11
109 0.11
110 0.11
111 0.18
112 0.18
113 0.15
114 0.16
115 0.14
116 0.14
117 0.13
118 0.14
119 0.07
120 0.08
121 0.08
122 0.08
123 0.09
124 0.09
125 0.1
126 0.1
127 0.09
128 0.08
129 0.07
130 0.06
131 0.07
132 0.1
133 0.13
134 0.17
135 0.18
136 0.19
137 0.2
138 0.23
139 0.25
140 0.31
141 0.35
142 0.4
143 0.45
144 0.45
145 0.46
146 0.45
147 0.47
148 0.39
149 0.32
150 0.31
151 0.34
152 0.41
153 0.4
154 0.4
155 0.4
156 0.43
157 0.51
158 0.48
159 0.46
160 0.47
161 0.52
162 0.59
163 0.64
164 0.62
165 0.59
166 0.56
167 0.54
168 0.45
169 0.4
170 0.32
171 0.22
172 0.19
173 0.14
174 0.13
175 0.1
176 0.1
177 0.11
178 0.11
179 0.11
180 0.11
181 0.14
182 0.12
183 0.15
184 0.19
185 0.19
186 0.21
187 0.27
188 0.36
189 0.41
190 0.46
191 0.53
192 0.52
193 0.55
194 0.62
195 0.63
196 0.63
197 0.59
198 0.61
199 0.59
200 0.59
201 0.6
202 0.58
203 0.56
204 0.57
205 0.56
206 0.51
207 0.45
208 0.42
209 0.37
210 0.31
211 0.27
212 0.22
213 0.21
214 0.19
215 0.18
216 0.22
217 0.22
218 0.26
219 0.25
220 0.22
221 0.2
222 0.23
223 0.28
224 0.26
225 0.25
226 0.23
227 0.25
228 0.3
229 0.34
230 0.39
231 0.44