Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZRC5

Protein Details
Accession G8ZRC5    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-28STPPGGQRTLQKRRQAQNVKDKQLKQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, plas 6, nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR030671  Sec61-beta/Sbh  
IPR016482  SecG/Sec61-beta/Sbh  
Gene Ontology GO:0005784  C:Sec61 translocon complex  
GO:0006886  P:intracellular protein transport  
KEGG tdl:TDEL_0C01780  -  
Pfam View protein in Pfam  
PF03911  Sec61_beta  
Amino Acid Sequences MSSTPPGGQRTLQKRRQAQNVKDKQLKQTPASTRQAGHGGSSSSILKIYTDEANGLRVDPLVVLFLAVAFIFSVVAMHVISKVTGKLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.8
4 0.81
5 0.8
6 0.81
7 0.83
8 0.83
9 0.82
10 0.77
11 0.74
12 0.71
13 0.67
14 0.59
15 0.57
16 0.55
17 0.55
18 0.57
19 0.51
20 0.43
21 0.4
22 0.4
23 0.32
24 0.26
25 0.19
26 0.14
27 0.13
28 0.13
29 0.11
30 0.08
31 0.08
32 0.07
33 0.06
34 0.06
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.11
41 0.1
42 0.1
43 0.08
44 0.07
45 0.07
46 0.06
47 0.06
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.05
65 0.05
66 0.06
67 0.07
68 0.08