Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N7S2

Protein Details
Accession A0A1Y3N7S2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-76LSKTILKSKKVKKCSNIKDLRGFIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10, cyto_nucl 7.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MIYEKGKNHFQIVKIVPHATKNIYANPKSRSAKLRCLIFKTSRDSIKTKSNYLSKTILKSKKVKKCSNIKDLRGFIPLFEELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.38
4 0.36
5 0.36
6 0.3
7 0.3
8 0.27
9 0.31
10 0.35
11 0.38
12 0.4
13 0.41
14 0.47
15 0.46
16 0.48
17 0.5
18 0.47
19 0.53
20 0.53
21 0.57
22 0.51
23 0.53
24 0.54
25 0.5
26 0.48
27 0.44
28 0.43
29 0.39
30 0.39
31 0.38
32 0.36
33 0.4
34 0.39
35 0.36
36 0.38
37 0.4
38 0.39
39 0.4
40 0.43
41 0.36
42 0.4
43 0.47
44 0.47
45 0.48
46 0.56
47 0.62
48 0.66
49 0.73
50 0.75
51 0.75
52 0.8
53 0.82
54 0.84
55 0.84
56 0.81
57 0.81
58 0.76
59 0.69
60 0.63
61 0.54
62 0.43
63 0.37