Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N490

Protein Details
Accession A0A1Y3N490    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
138-159AVATRKSKAKPHKAKPYDKTTQHydrophilic
NLS Segment(s)
PositionSequence
143-151KSKAKPHKA
Subcellular Location(s) nucl 15, cyto_nucl 12, mito 5, cyto 5
Family & Domain DBs
Amino Acid Sequences MFDAAKLQKVLPHLSDYGKDVESWIVIVAECDSLNEAFKIAEIAEEAEKEIIANTSQTNLNNNIGPAVMIAQDGRRTTSDKQTNNTPSNYLMTTVTNELYNKQNINETTEYNNINNNNSLYGNQNFEQTTNYSPEVLAVATRKSKAKPHKAKPYDKTTQINNLRDNPTPIHTAAMSHNSQSPNNNANNNMNNNMNNNMNNNMNNKNIGNIDNNMTNDHNLDNMNNSNINIDNNNNNLNNNNINNLNNINNNNNTNNNNLNNNSLNNNNDLNKYNNNNYNTSTNMEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.31
4 0.31
5 0.27
6 0.24
7 0.21
8 0.19
9 0.16
10 0.15
11 0.12
12 0.09
13 0.08
14 0.09
15 0.08
16 0.08
17 0.08
18 0.08
19 0.09
20 0.09
21 0.1
22 0.1
23 0.1
24 0.08
25 0.08
26 0.09
27 0.07
28 0.07
29 0.06
30 0.08
31 0.09
32 0.09
33 0.1
34 0.09
35 0.09
36 0.09
37 0.09
38 0.07
39 0.07
40 0.08
41 0.07
42 0.1
43 0.13
44 0.14
45 0.17
46 0.19
47 0.21
48 0.21
49 0.2
50 0.18
51 0.15
52 0.14
53 0.11
54 0.09
55 0.07
56 0.06
57 0.06
58 0.07
59 0.1
60 0.11
61 0.13
62 0.13
63 0.17
64 0.2
65 0.3
66 0.37
67 0.38
68 0.41
69 0.48
70 0.55
71 0.55
72 0.53
73 0.45
74 0.38
75 0.36
76 0.33
77 0.25
78 0.18
79 0.15
80 0.15
81 0.15
82 0.14
83 0.13
84 0.13
85 0.13
86 0.16
87 0.18
88 0.17
89 0.16
90 0.2
91 0.19
92 0.25
93 0.24
94 0.22
95 0.23
96 0.25
97 0.26
98 0.22
99 0.25
100 0.21
101 0.21
102 0.2
103 0.17
104 0.15
105 0.14
106 0.14
107 0.14
108 0.14
109 0.16
110 0.15
111 0.17
112 0.15
113 0.15
114 0.16
115 0.14
116 0.14
117 0.14
118 0.14
119 0.12
120 0.12
121 0.12
122 0.11
123 0.09
124 0.08
125 0.06
126 0.08
127 0.09
128 0.11
129 0.13
130 0.14
131 0.21
132 0.3
133 0.41
134 0.49
135 0.57
136 0.67
137 0.74
138 0.82
139 0.81
140 0.8
141 0.75
142 0.71
143 0.65
144 0.57
145 0.58
146 0.56
147 0.54
148 0.49
149 0.48
150 0.45
151 0.43
152 0.42
153 0.34
154 0.29
155 0.26
156 0.23
157 0.18
158 0.15
159 0.16
160 0.15
161 0.19
162 0.17
163 0.15
164 0.19
165 0.19
166 0.21
167 0.21
168 0.24
169 0.25
170 0.28
171 0.29
172 0.28
173 0.31
174 0.35
175 0.35
176 0.33
177 0.29
178 0.27
179 0.27
180 0.26
181 0.24
182 0.2
183 0.19
184 0.19
185 0.19
186 0.21
187 0.23
188 0.24
189 0.23
190 0.24
191 0.22
192 0.22
193 0.22
194 0.21
195 0.2
196 0.19
197 0.2
198 0.21
199 0.22
200 0.22
201 0.21
202 0.19
203 0.18
204 0.16
205 0.15
206 0.12
207 0.12
208 0.13
209 0.14
210 0.16
211 0.15
212 0.15
213 0.15
214 0.16
215 0.17
216 0.15
217 0.16
218 0.19
219 0.2
220 0.25
221 0.24
222 0.24
223 0.23
224 0.26
225 0.28
226 0.25
227 0.26
228 0.24
229 0.24
230 0.25
231 0.27
232 0.26
233 0.26
234 0.28
235 0.3
236 0.32
237 0.35
238 0.36
239 0.38
240 0.37
241 0.37
242 0.4
243 0.39
244 0.4
245 0.38
246 0.39
247 0.37
248 0.37
249 0.36
250 0.34
251 0.32
252 0.31
253 0.34
254 0.31
255 0.32
256 0.33
257 0.34
258 0.38
259 0.42
260 0.47
261 0.5
262 0.51
263 0.51
264 0.52
265 0.51
266 0.46