Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NBT1

Protein Details
Accession A0A1Y3NBT1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
48-70PASKKASKTVTPKKYRKNFVIRIHydrophilic
NLS Segment(s)
PositionSequence
45-64KKQPASKKASKTVTPKKYRK
Subcellular Location(s) cyto 12.5, cyto_nucl 10.5, nucl 7.5, mito 7
Family & Domain DBs
Amino Acid Sequences MLLIKYIDYLPLIPQPINYPKETTKLASINSKATVAPKKTNTVVKKQPASKKASKTVTPKKYRKNFVIRIPRTIFKSDGPKRITITRTTPPATIEYEIPTHTNAEETTTYYSTFGYDFISPSPKLSKVYRTRKTPLTKNKVPVTNASNSQGTVPVTKASNNSVTTPVTKISKQTETVPVTKAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.3
4 0.33
5 0.33
6 0.33
7 0.34
8 0.38
9 0.4
10 0.36
11 0.34
12 0.34
13 0.35
14 0.38
15 0.38
16 0.37
17 0.35
18 0.34
19 0.28
20 0.31
21 0.36
22 0.33
23 0.38
24 0.38
25 0.41
26 0.45
27 0.53
28 0.52
29 0.53
30 0.58
31 0.59
32 0.63
33 0.67
34 0.71
35 0.69
36 0.73
37 0.71
38 0.7
39 0.7
40 0.68
41 0.66
42 0.68
43 0.71
44 0.73
45 0.76
46 0.77
47 0.78
48 0.82
49 0.82
50 0.81
51 0.81
52 0.77
53 0.77
54 0.79
55 0.71
56 0.7
57 0.66
58 0.61
59 0.54
60 0.49
61 0.4
62 0.33
63 0.41
64 0.39
65 0.43
66 0.42
67 0.4
68 0.4
69 0.44
70 0.42
71 0.35
72 0.34
73 0.31
74 0.33
75 0.33
76 0.31
77 0.27
78 0.27
79 0.25
80 0.2
81 0.17
82 0.14
83 0.13
84 0.13
85 0.12
86 0.11
87 0.1
88 0.09
89 0.09
90 0.07
91 0.09
92 0.09
93 0.1
94 0.12
95 0.12
96 0.12
97 0.12
98 0.12
99 0.1
100 0.1
101 0.09
102 0.08
103 0.08
104 0.08
105 0.09
106 0.13
107 0.13
108 0.14
109 0.17
110 0.16
111 0.19
112 0.21
113 0.3
114 0.37
115 0.48
116 0.54
117 0.58
118 0.62
119 0.68
120 0.74
121 0.74
122 0.75
123 0.74
124 0.73
125 0.74
126 0.76
127 0.73
128 0.67
129 0.63
130 0.57
131 0.53
132 0.49
133 0.44
134 0.37
135 0.31
136 0.3
137 0.27
138 0.23
139 0.19
140 0.16
141 0.16
142 0.16
143 0.18
144 0.19
145 0.21
146 0.25
147 0.25
148 0.27
149 0.27
150 0.28
151 0.28
152 0.28
153 0.28
154 0.26
155 0.26
156 0.29
157 0.33
158 0.36
159 0.37
160 0.4
161 0.45
162 0.47
163 0.49