Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NFF6

Protein Details
Accession A0A1Y3NFF6    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-30GCGKVFKRSEHLKRHNRVHTGBasic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PF13912  zf-C2H2_6  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences VKHFICPYEGCGKVFKRSEHLKRHNRVHTGERPFACDECHKRFSRSDNLAQHKKTHRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.39
4 0.47
5 0.55
6 0.6
7 0.68
8 0.7
9 0.74
10 0.81
11 0.8
12 0.75
13 0.69
14 0.66
15 0.64
16 0.6
17 0.58
18 0.49
19 0.46
20 0.43
21 0.39
22 0.33
23 0.33
24 0.33
25 0.34
26 0.41
27 0.39
28 0.41
29 0.45
30 0.5
31 0.52
32 0.53
33 0.54
34 0.57
35 0.65
36 0.71
37 0.69
38 0.71