Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NCL4

Protein Details
Accession A0A1Y3NCL4   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-91REGPRKIISYTRKRIWKRKAVYYSHydrophilic
NLS Segment(s)
PositionSequence
79-85RKRIWKR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010482  Peroxin  
Gene Ontology GO:0005778  C:peroxisomal membrane  
GO:0007031  P:peroxisome organization  
Pfam View protein in Pfam  
PF06398  Pex24p  
Amino Acid Sequences TGFTDLLLHNDPPNYSTNYKEPKEALPSSLDNYPLPPNYRFLPDESWEIEMDHGDEEGWIYMDNIWRREGPRKIISYTRKRIWKRKAVYYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.25
4 0.31
5 0.38
6 0.39
7 0.41
8 0.4
9 0.38
10 0.44
11 0.41
12 0.34
13 0.3
14 0.3
15 0.29
16 0.28
17 0.26
18 0.18
19 0.19
20 0.2
21 0.19
22 0.21
23 0.19
24 0.2
25 0.2
26 0.23
27 0.22
28 0.21
29 0.22
30 0.21
31 0.22
32 0.21
33 0.21
34 0.17
35 0.17
36 0.14
37 0.11
38 0.09
39 0.07
40 0.06
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.1
50 0.13
51 0.14
52 0.16
53 0.18
54 0.21
55 0.3
56 0.34
57 0.37
58 0.42
59 0.45
60 0.47
61 0.54
62 0.61
63 0.63
64 0.67
65 0.68
66 0.7
67 0.76
68 0.82
69 0.84
70 0.84
71 0.81