Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NAH3

Protein Details
Accession A0A1Y3NAH3    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
101-127TSSKLSPHKIRLKPNARPIKQKFYRLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 5
Family & Domain DBs
Amino Acid Sequences MDLKMFIHPILYSLCQFYPDGLIKFIAPINNKYEDEEKLMYVIKATPTEKSDLKKLEGLPPREYINNKVFVNSIEPQYRKIIKKLLETNIDIIATSSEELTSSKLSPHKIRLKPNARPIKQKFYRLTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.18
4 0.17
5 0.19
6 0.21
7 0.21
8 0.2
9 0.2
10 0.18
11 0.2
12 0.21
13 0.19
14 0.18
15 0.19
16 0.22
17 0.26
18 0.27
19 0.28
20 0.29
21 0.27
22 0.28
23 0.26
24 0.22
25 0.19
26 0.19
27 0.16
28 0.14
29 0.14
30 0.11
31 0.13
32 0.14
33 0.15
34 0.16
35 0.19
36 0.22
37 0.22
38 0.27
39 0.26
40 0.27
41 0.29
42 0.28
43 0.33
44 0.37
45 0.38
46 0.35
47 0.34
48 0.34
49 0.33
50 0.33
51 0.29
52 0.26
53 0.28
54 0.25
55 0.24
56 0.23
57 0.21
58 0.24
59 0.2
60 0.2
61 0.2
62 0.21
63 0.22
64 0.27
65 0.33
66 0.31
67 0.32
68 0.35
69 0.34
70 0.41
71 0.46
72 0.47
73 0.45
74 0.45
75 0.43
76 0.38
77 0.34
78 0.26
79 0.19
80 0.13
81 0.09
82 0.08
83 0.06
84 0.05
85 0.06
86 0.06
87 0.08
88 0.09
89 0.09
90 0.13
91 0.17
92 0.23
93 0.28
94 0.37
95 0.46
96 0.51
97 0.61
98 0.68
99 0.74
100 0.77
101 0.83
102 0.84
103 0.8
104 0.84
105 0.81
106 0.82
107 0.8
108 0.8