Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NE06

Protein Details
Accession A0A1Y3NE06   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
41-70SNVDNKKDLKKIKKQTTRKPWAPKERKEGEBasic
NLS Segment(s)
PositionSequence
46-80KKDLKKIKKQTTRKPWAPKERKEGEVVEKRRPKKK
Subcellular Location(s) nucl 18, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR001406  PsdUridine_synth_TruA  
IPR020094  TruA/RsuA/RluB/E/F_N  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
Amino Acid Sequences MDIDNKETPSVEESVETSTTEQTIEENGKRKINEIENSSESNVDNKKDLKKIKKQTTRKPWAPKERKEGEVVEKRRPKKKCALLMGFCGTGYQGMQINPGAKTIEGDLWKALVEAKAVSKDNAEDPKKISFVRAARTDKGVHAIGQVISGKFIIEDEDIVDKINAALPEQIRVWGNIFNKYCYINI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.15
5 0.14
6 0.14
7 0.13
8 0.12
9 0.09
10 0.12
11 0.17
12 0.21
13 0.26
14 0.3
15 0.34
16 0.34
17 0.37
18 0.4
19 0.42
20 0.44
21 0.42
22 0.45
23 0.43
24 0.45
25 0.43
26 0.37
27 0.29
28 0.29
29 0.27
30 0.22
31 0.22
32 0.25
33 0.29
34 0.36
35 0.44
36 0.49
37 0.56
38 0.65
39 0.73
40 0.79
41 0.83
42 0.87
43 0.89
44 0.9
45 0.89
46 0.89
47 0.88
48 0.89
49 0.89
50 0.86
51 0.84
52 0.79
53 0.72
54 0.65
55 0.58
56 0.56
57 0.56
58 0.52
59 0.51
60 0.53
61 0.57
62 0.61
63 0.61
64 0.58
65 0.58
66 0.63
67 0.62
68 0.64
69 0.66
70 0.6
71 0.61
72 0.57
73 0.47
74 0.38
75 0.3
76 0.2
77 0.12
78 0.09
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.09
85 0.09
86 0.1
87 0.09
88 0.07
89 0.08
90 0.08
91 0.1
92 0.1
93 0.1
94 0.1
95 0.1
96 0.1
97 0.09
98 0.09
99 0.06
100 0.06
101 0.06
102 0.07
103 0.11
104 0.11
105 0.12
106 0.11
107 0.12
108 0.17
109 0.25
110 0.26
111 0.24
112 0.26
113 0.28
114 0.3
115 0.29
116 0.26
117 0.24
118 0.25
119 0.3
120 0.36
121 0.38
122 0.38
123 0.41
124 0.41
125 0.35
126 0.36
127 0.3
128 0.22
129 0.19
130 0.19
131 0.15
132 0.16
133 0.18
134 0.13
135 0.13
136 0.12
137 0.11
138 0.09
139 0.09
140 0.09
141 0.07
142 0.07
143 0.08
144 0.11
145 0.11
146 0.12
147 0.11
148 0.1
149 0.09
150 0.13
151 0.11
152 0.1
153 0.15
154 0.14
155 0.17
156 0.18
157 0.21
158 0.18
159 0.19
160 0.2
161 0.22
162 0.24
163 0.3
164 0.31
165 0.31
166 0.32