Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N6X3

Protein Details
Accession A0A1Y3N6X3   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-42ATKQEIRKSYKKLSRKYHPDKNPGNKEAEHydrophilic
NLS Segment(s)
PositionSequence
24-25KK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR044713  DNJA1/2-like  
IPR001305  HSP_DnaJ_Cys-rich_dom  
IPR036410  HSP_DnaJ_Cys-rich_dom_sf  
IPR036869  J_dom_sf  
Gene Ontology GO:0030544  F:Hsp70 protein binding  
GO:0046872  F:metal ion binding  
GO:0051082  F:unfolded protein binding  
GO:0006457  P:protein folding  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
PS51188  ZF_CR  
CDD cd06257  DnaJ  
cd10719  DnaJ_zf  
Amino Acid Sequences AEDYYDILQVKRHATKQEIRKSYKKLSRKYHPDKNPGNKEAEEKFLKITEAYEVLMDDEKRNIYNKFGKDGLKNRQEQRGNPFSFFHNFNNGGQEEERKGPSIKIDVAVSLKELYLGTTIDIDVNKRMICPHCGGTGANGYDGFRTCHVCGGTGQKKLQFMLGPGIFQQVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.58
4 0.65
5 0.68
6 0.69
7 0.73
8 0.75
9 0.78
10 0.79
11 0.78
12 0.77
13 0.78
14 0.81
15 0.84
16 0.87
17 0.87
18 0.87
19 0.88
20 0.88
21 0.89
22 0.88
23 0.8
24 0.75
25 0.66
26 0.62
27 0.54
28 0.51
29 0.42
30 0.33
31 0.31
32 0.27
33 0.26
34 0.2
35 0.19
36 0.13
37 0.12
38 0.11
39 0.1
40 0.09
41 0.09
42 0.11
43 0.11
44 0.1
45 0.1
46 0.11
47 0.12
48 0.14
49 0.14
50 0.17
51 0.24
52 0.25
53 0.27
54 0.29
55 0.32
56 0.36
57 0.42
58 0.46
59 0.46
60 0.5
61 0.5
62 0.55
63 0.55
64 0.52
65 0.52
66 0.53
67 0.47
68 0.42
69 0.4
70 0.34
71 0.33
72 0.33
73 0.26
74 0.22
75 0.22
76 0.21
77 0.23
78 0.21
79 0.2
80 0.17
81 0.18
82 0.15
83 0.16
84 0.16
85 0.15
86 0.15
87 0.14
88 0.16
89 0.16
90 0.15
91 0.14
92 0.14
93 0.13
94 0.14
95 0.13
96 0.12
97 0.1
98 0.09
99 0.08
100 0.08
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.07
107 0.07
108 0.08
109 0.09
110 0.09
111 0.11
112 0.11
113 0.11
114 0.15
115 0.16
116 0.2
117 0.22
118 0.23
119 0.22
120 0.24
121 0.23
122 0.22
123 0.25
124 0.22
125 0.19
126 0.17
127 0.16
128 0.17
129 0.18
130 0.17
131 0.13
132 0.17
133 0.16
134 0.21
135 0.21
136 0.2
137 0.22
138 0.31
139 0.36
140 0.38
141 0.41
142 0.4
143 0.41
144 0.41
145 0.42
146 0.33
147 0.29
148 0.32
149 0.29
150 0.27
151 0.25