Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NRH8

Protein Details
Accession A0A1Y3NRH8   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-32NNSNDNGYKNLRRRKNNNNNSDNNDNVHydrophilic
34-60NQVINNNKNKNNKKFGNRDNNKNNGKTHydrophilic
65-93NTTLQKPNGRRNGKNKKHQLTNNKQENKQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, nucl 7.5, mito 7, cyto_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTKNNNNSNDNGYKNLRRRKNNNNNSDNNDNVNNQVINNNKNKNNKKFGNRDNNKNNGKTNVNDNTTLQKPNGRRNGKNKKHQLTNNKQENKQINNNTINNNENLTIRAVLFKISLSVVNFVVNTPITVYCVVKNVKEMVCFIEIGIGIGIVFFLIRITRFYKNKLIISCRNVLKYFNLSELNNKIKSAFSTKEIINNLLKKSTEVVNILYNQTKQIIVDSSKTTINYSYKVVNSTTPVIKDTSYQIYSTISSTVVRSIPYFQKSTDQIQSVINSTISALLNNEKLNGMAHSVKDAVSNTIPKNVSSGNEIYQSVYNVIDRYQKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.65
3 0.67
4 0.71
5 0.77
6 0.83
7 0.87
8 0.88
9 0.89
10 0.89
11 0.88
12 0.85
13 0.82
14 0.73
15 0.66
16 0.59
17 0.49
18 0.41
19 0.36
20 0.29
21 0.24
22 0.26
23 0.26
24 0.3
25 0.37
26 0.43
27 0.47
28 0.57
29 0.66
30 0.7
31 0.75
32 0.77
33 0.79
34 0.82
35 0.86
36 0.87
37 0.85
38 0.87
39 0.86
40 0.87
41 0.85
42 0.79
43 0.73
44 0.68
45 0.63
46 0.55
47 0.54
48 0.52
49 0.48
50 0.44
51 0.41
52 0.41
53 0.41
54 0.4
55 0.33
56 0.32
57 0.34
58 0.42
59 0.5
60 0.52
61 0.57
62 0.66
63 0.76
64 0.79
65 0.85
66 0.86
67 0.84
68 0.85
69 0.86
70 0.86
71 0.85
72 0.86
73 0.86
74 0.83
75 0.77
76 0.75
77 0.74
78 0.7
79 0.68
80 0.63
81 0.6
82 0.6
83 0.61
84 0.56
85 0.52
86 0.47
87 0.39
88 0.34
89 0.27
90 0.2
91 0.18
92 0.16
93 0.13
94 0.11
95 0.12
96 0.11
97 0.1
98 0.1
99 0.09
100 0.08
101 0.08
102 0.09
103 0.09
104 0.1
105 0.1
106 0.1
107 0.1
108 0.09
109 0.1
110 0.08
111 0.08
112 0.07
113 0.07
114 0.07
115 0.09
116 0.09
117 0.09
118 0.14
119 0.15
120 0.14
121 0.16
122 0.18
123 0.18
124 0.18
125 0.18
126 0.16
127 0.16
128 0.15
129 0.13
130 0.11
131 0.1
132 0.09
133 0.08
134 0.06
135 0.04
136 0.04
137 0.04
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.03
144 0.05
145 0.09
146 0.15
147 0.17
148 0.21
149 0.27
150 0.3
151 0.34
152 0.35
153 0.39
154 0.39
155 0.41
156 0.44
157 0.4
158 0.39
159 0.36
160 0.33
161 0.29
162 0.26
163 0.23
164 0.2
165 0.2
166 0.18
167 0.21
168 0.25
169 0.28
170 0.25
171 0.24
172 0.22
173 0.2
174 0.21
175 0.23
176 0.19
177 0.17
178 0.2
179 0.21
180 0.25
181 0.26
182 0.28
183 0.27
184 0.29
185 0.27
186 0.26
187 0.26
188 0.21
189 0.22
190 0.21
191 0.19
192 0.17
193 0.17
194 0.18
195 0.19
196 0.21
197 0.21
198 0.18
199 0.16
200 0.16
201 0.15
202 0.11
203 0.12
204 0.13
205 0.13
206 0.15
207 0.16
208 0.17
209 0.19
210 0.19
211 0.19
212 0.2
213 0.2
214 0.19
215 0.19
216 0.21
217 0.21
218 0.23
219 0.23
220 0.2
221 0.21
222 0.23
223 0.24
224 0.21
225 0.21
226 0.2
227 0.2
228 0.2
229 0.2
230 0.22
231 0.21
232 0.2
233 0.19
234 0.2
235 0.2
236 0.19
237 0.17
238 0.11
239 0.11
240 0.11
241 0.13
242 0.13
243 0.13
244 0.13
245 0.17
246 0.23
247 0.26
248 0.27
249 0.26
250 0.31
251 0.34
252 0.39
253 0.39
254 0.35
255 0.32
256 0.33
257 0.34
258 0.3
259 0.28
260 0.22
261 0.16
262 0.14
263 0.17
264 0.14
265 0.13
266 0.12
267 0.14
268 0.17
269 0.17
270 0.18
271 0.14
272 0.15
273 0.15
274 0.14
275 0.15
276 0.15
277 0.16
278 0.17
279 0.18
280 0.17
281 0.19
282 0.19
283 0.19
284 0.2
285 0.26
286 0.25
287 0.32
288 0.33
289 0.3
290 0.32
291 0.31
292 0.28
293 0.27
294 0.29
295 0.24
296 0.27
297 0.28
298 0.27
299 0.26
300 0.26
301 0.22
302 0.2
303 0.19
304 0.16
305 0.18