Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NFW7

Protein Details
Accession A0A1Y3NFW7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-42RTIIQPLKFNKKSPKPENDIIADHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004294  Carotenoid_Oase  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0016702  F:oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen  
Pfam View protein in Pfam  
PF03055  RPE65  
Amino Acid Sequences MSDKVSGLWSHNVNQSSFSRTIIQPLKFNKKSPKPENDIIADSITSQFPSKFRKGAVATFNCTGNIRFIDDNLKGEKVINYTDINNTFKTSYCSPHPIRDPYSGRMINVLSEIGLTFTKFKVIEFDEESSNIIAEINAPISPIHSFAITENYIIIVRIISFPFILKRRGLSYFTGESILSSFDYNPDGLTTFYRENRHIATYTANACYGINAYETNMTIWIDYSIYDNDNLVRNLTIDNIRNATQLSIPSSKIIRFSLDLNEVNSTDSNFNPNNTILQASFAHLSQDISIELPVINENYIGRNYKFAYGVGLPFTDATPGKYYDRIKKIDVEKEQFITWNEPHCYPSYPIFVPNPSNTDDEDEGVVLSSIYDGSKDESFLLILNAKDMTEITRIALPVTVAPSFTSPAYSTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.36
4 0.34
5 0.31
6 0.31
7 0.28
8 0.37
9 0.4
10 0.41
11 0.42
12 0.5
13 0.59
14 0.58
15 0.65
16 0.67
17 0.69
18 0.77
19 0.8
20 0.81
21 0.79
22 0.81
23 0.8
24 0.74
25 0.67
26 0.58
27 0.49
28 0.39
29 0.31
30 0.26
31 0.2
32 0.16
33 0.14
34 0.15
35 0.18
36 0.26
37 0.3
38 0.31
39 0.32
40 0.39
41 0.41
42 0.46
43 0.52
44 0.5
45 0.5
46 0.48
47 0.48
48 0.41
49 0.38
50 0.32
51 0.25
52 0.21
53 0.2
54 0.18
55 0.18
56 0.24
57 0.24
58 0.27
59 0.26
60 0.25
61 0.22
62 0.23
63 0.24
64 0.2
65 0.2
66 0.19
67 0.18
68 0.19
69 0.25
70 0.27
71 0.27
72 0.26
73 0.26
74 0.24
75 0.23
76 0.26
77 0.24
78 0.24
79 0.27
80 0.35
81 0.36
82 0.43
83 0.49
84 0.5
85 0.52
86 0.56
87 0.55
88 0.5
89 0.56
90 0.49
91 0.43
92 0.39
93 0.35
94 0.26
95 0.23
96 0.19
97 0.1
98 0.09
99 0.08
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.11
106 0.11
107 0.11
108 0.14
109 0.16
110 0.2
111 0.22
112 0.24
113 0.22
114 0.22
115 0.23
116 0.18
117 0.16
118 0.12
119 0.09
120 0.06
121 0.06
122 0.06
123 0.06
124 0.05
125 0.06
126 0.06
127 0.06
128 0.07
129 0.08
130 0.07
131 0.07
132 0.07
133 0.08
134 0.13
135 0.12
136 0.12
137 0.1
138 0.11
139 0.1
140 0.1
141 0.09
142 0.05
143 0.05
144 0.07
145 0.07
146 0.06
147 0.07
148 0.07
149 0.12
150 0.14
151 0.16
152 0.16
153 0.17
154 0.2
155 0.23
156 0.25
157 0.22
158 0.25
159 0.24
160 0.24
161 0.23
162 0.2
163 0.17
164 0.15
165 0.13
166 0.09
167 0.07
168 0.07
169 0.06
170 0.07
171 0.07
172 0.07
173 0.06
174 0.07
175 0.07
176 0.07
177 0.1
178 0.11
179 0.15
180 0.18
181 0.19
182 0.2
183 0.21
184 0.23
185 0.2
186 0.19
187 0.17
188 0.17
189 0.18
190 0.17
191 0.15
192 0.13
193 0.12
194 0.12
195 0.1
196 0.07
197 0.06
198 0.05
199 0.06
200 0.06
201 0.07
202 0.07
203 0.07
204 0.06
205 0.06
206 0.06
207 0.06
208 0.05
209 0.05
210 0.07
211 0.07
212 0.07
213 0.08
214 0.08
215 0.09
216 0.11
217 0.11
218 0.1
219 0.09
220 0.09
221 0.09
222 0.11
223 0.13
224 0.12
225 0.13
226 0.15
227 0.15
228 0.15
229 0.15
230 0.14
231 0.12
232 0.12
233 0.14
234 0.14
235 0.14
236 0.16
237 0.17
238 0.17
239 0.18
240 0.17
241 0.15
242 0.14
243 0.16
244 0.18
245 0.21
246 0.21
247 0.2
248 0.21
249 0.19
250 0.19
251 0.17
252 0.15
253 0.12
254 0.11
255 0.15
256 0.15
257 0.15
258 0.16
259 0.16
260 0.16
261 0.15
262 0.16
263 0.11
264 0.13
265 0.13
266 0.12
267 0.13
268 0.11
269 0.12
270 0.11
271 0.11
272 0.09
273 0.09
274 0.08
275 0.07
276 0.07
277 0.07
278 0.06
279 0.06
280 0.07
281 0.07
282 0.06
283 0.07
284 0.07
285 0.09
286 0.11
287 0.14
288 0.14
289 0.17
290 0.18
291 0.2
292 0.21
293 0.19
294 0.2
295 0.19
296 0.19
297 0.17
298 0.16
299 0.14
300 0.13
301 0.13
302 0.13
303 0.11
304 0.12
305 0.14
306 0.17
307 0.18
308 0.24
309 0.3
310 0.36
311 0.44
312 0.45
313 0.44
314 0.5
315 0.55
316 0.58
317 0.61
318 0.57
319 0.54
320 0.52
321 0.5
322 0.45
323 0.4
324 0.37
325 0.31
326 0.32
327 0.32
328 0.3
329 0.32
330 0.31
331 0.33
332 0.3
333 0.32
334 0.3
335 0.29
336 0.32
337 0.33
338 0.35
339 0.36
340 0.36
341 0.35
342 0.32
343 0.32
344 0.29
345 0.31
346 0.28
347 0.25
348 0.22
349 0.19
350 0.16
351 0.15
352 0.13
353 0.08
354 0.06
355 0.05
356 0.05
357 0.05
358 0.05
359 0.06
360 0.09
361 0.1
362 0.11
363 0.12
364 0.12
365 0.12
366 0.12
367 0.14
368 0.14
369 0.13
370 0.14
371 0.13
372 0.13
373 0.13
374 0.13
375 0.13
376 0.12
377 0.13
378 0.13
379 0.16
380 0.16
381 0.16
382 0.17
383 0.15
384 0.15
385 0.18
386 0.17
387 0.14
388 0.15
389 0.16
390 0.17
391 0.16
392 0.17