Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N224

Protein Details
Accession A0A1Y3N224    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-32NIENNDRKKLSRNRLKKDTSKKYKLEDEIHydrophilic
NLS Segment(s)
PositionSequence
14-20SRNRLKK
Subcellular Location(s) nucl 14, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR003439  ABC_transporter-like_ATP-bd  
IPR026082  ABCA  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016020  C:membrane  
GO:0140359  F:ABC-type transporter activity  
GO:0005524  F:ATP binding  
Pfam View protein in Pfam  
PF00005  ABC_tran  
Amino Acid Sequences MLLNIENNDRKKLSRNRLKKDTSKKYKLEDEIDNLNDNENIKREIEYVNSNKSLLPISVIHLNKDFNVEISDTKVKDYINNKKTFKYGEVHPSPYIASQYIKTVIEDVTFCVKENECFGLLGPNGVGKSTIFNILISNFKMTTGGIYFNGIDHYKSNNIIGYCSQANVLWDELTESKIIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.73
4 0.81
5 0.88
6 0.89
7 0.89
8 0.89
9 0.89
10 0.88
11 0.84
12 0.81
13 0.81
14 0.77
15 0.71
16 0.65
17 0.59
18 0.55
19 0.51
20 0.46
21 0.38
22 0.32
23 0.28
24 0.24
25 0.21
26 0.16
27 0.16
28 0.14
29 0.15
30 0.16
31 0.16
32 0.17
33 0.23
34 0.25
35 0.28
36 0.28
37 0.28
38 0.27
39 0.26
40 0.24
41 0.17
42 0.15
43 0.11
44 0.12
45 0.19
46 0.19
47 0.2
48 0.2
49 0.2
50 0.18
51 0.2
52 0.18
53 0.11
54 0.12
55 0.11
56 0.1
57 0.14
58 0.17
59 0.15
60 0.15
61 0.16
62 0.15
63 0.2
64 0.27
65 0.33
66 0.38
67 0.46
68 0.47
69 0.47
70 0.49
71 0.45
72 0.4
73 0.33
74 0.29
75 0.31
76 0.33
77 0.34
78 0.32
79 0.31
80 0.28
81 0.25
82 0.22
83 0.13
84 0.11
85 0.08
86 0.1
87 0.11
88 0.11
89 0.11
90 0.11
91 0.1
92 0.1
93 0.1
94 0.1
95 0.13
96 0.12
97 0.13
98 0.14
99 0.14
100 0.14
101 0.15
102 0.16
103 0.12
104 0.12
105 0.11
106 0.14
107 0.13
108 0.13
109 0.11
110 0.1
111 0.09
112 0.09
113 0.1
114 0.06
115 0.08
116 0.09
117 0.11
118 0.1
119 0.11
120 0.12
121 0.13
122 0.15
123 0.14
124 0.15
125 0.13
126 0.12
127 0.13
128 0.12
129 0.12
130 0.11
131 0.12
132 0.1
133 0.12
134 0.12
135 0.12
136 0.15
137 0.14
138 0.13
139 0.13
140 0.16
141 0.18
142 0.19
143 0.2
144 0.21
145 0.2
146 0.22
147 0.21
148 0.22
149 0.2
150 0.19
151 0.19
152 0.16
153 0.17
154 0.16
155 0.17
156 0.12
157 0.11
158 0.14
159 0.14
160 0.15