Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NAZ7

Protein Details
Accession A0A1Y3NAZ7    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
134-157DFKESKLSEKRTKKIYNRLDSKVNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, E.R. 7, mito 4, extr 3, nucl 2.5, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016439  Lag1/Lac1-like  
IPR006634  TLC-dom  
Gene Ontology GO:0016020  C:membrane  
GO:0050291  F:sphingosine N-acyltransferase activity  
GO:0046513  P:ceramide biosynthetic process  
Pfam View protein in Pfam  
PF03798  TRAM_LAG1_CLN8  
PROSITE View protein in PROSITE  
PS50922  TLC  
Amino Acid Sequences MATLMLLIISFLNNYLRMGAVVLFLHDISDIFSYGCKIYVDTEYLKTTLFFYVSLVLTWFWTRLYVFPFEVILQCFTNNIWARPELVGYMIIAICLVTLLCLHIYWIILILNIGIKFLRTGEADDMQDAERTEDFKESKLSEKRTKKIYNRLDSKVNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.1
6 0.09
7 0.09
8 0.08
9 0.09
10 0.09
11 0.08
12 0.08
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.09
22 0.1
23 0.09
24 0.08
25 0.1
26 0.12
27 0.15
28 0.16
29 0.18
30 0.18
31 0.18
32 0.18
33 0.16
34 0.15
35 0.13
36 0.12
37 0.09
38 0.08
39 0.11
40 0.11
41 0.1
42 0.1
43 0.09
44 0.09
45 0.1
46 0.09
47 0.06
48 0.07
49 0.07
50 0.08
51 0.1
52 0.12
53 0.12
54 0.12
55 0.12
56 0.12
57 0.13
58 0.12
59 0.11
60 0.09
61 0.09
62 0.09
63 0.08
64 0.14
65 0.14
66 0.14
67 0.14
68 0.14
69 0.15
70 0.15
71 0.15
72 0.08
73 0.08
74 0.08
75 0.06
76 0.06
77 0.05
78 0.05
79 0.04
80 0.04
81 0.03
82 0.03
83 0.03
84 0.02
85 0.02
86 0.03
87 0.03
88 0.03
89 0.04
90 0.05
91 0.05
92 0.05
93 0.06
94 0.05
95 0.05
96 0.05
97 0.05
98 0.07
99 0.07
100 0.07
101 0.06
102 0.06
103 0.07
104 0.07
105 0.09
106 0.08
107 0.1
108 0.13
109 0.17
110 0.17
111 0.17
112 0.18
113 0.16
114 0.17
115 0.15
116 0.14
117 0.11
118 0.12
119 0.13
120 0.17
121 0.17
122 0.18
123 0.22
124 0.22
125 0.31
126 0.37
127 0.45
128 0.5
129 0.59
130 0.64
131 0.69
132 0.77
133 0.77
134 0.81
135 0.83
136 0.83
137 0.82
138 0.81