Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N7M8

Protein Details
Accession A0A1Y3N7M8   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
40-66VTRGKGFRNEKNKKKRGSYRGGKIDLABasic
NLS Segment(s)
PositionSequence
42-60RGKGFRNEKNKKKRGSYRG
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences KRIKDEDVVFLDERLKDNSFMAKGGAVGSYGEKAHRDLIVTRGKGFRNEKNKKKRGSYRGGKIDLASHSIKFNID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.18
4 0.19
5 0.23
6 0.2
7 0.19
8 0.17
9 0.14
10 0.13
11 0.12
12 0.11
13 0.07
14 0.06
15 0.06
16 0.07
17 0.07
18 0.08
19 0.08
20 0.09
21 0.1
22 0.1
23 0.1
24 0.1
25 0.16
26 0.22
27 0.21
28 0.22
29 0.25
30 0.26
31 0.32
32 0.36
33 0.38
34 0.43
35 0.53
36 0.61
37 0.68
38 0.76
39 0.77
40 0.82
41 0.84
42 0.83
43 0.83
44 0.83
45 0.82
46 0.84
47 0.8
48 0.71
49 0.62
50 0.56
51 0.47
52 0.42
53 0.34
54 0.25
55 0.23