Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N054

Protein Details
Accession A0A1Y3N054    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
115-135DGEIRRKKRIEEEKERLKNLVBasic
NLS Segment(s)
PositionSequence
100-107RLKKEKKD
115-130DGEIRRKKRIEEEKER
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039853  Pinin  
IPR006786  Pinin_SDK_MemA  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF04696  Pinin_SDK_memA  
Amino Acid Sequences MSRERDSKPSEIDTVSPQSERSERSEKSERKRSINSDDHSPKSATLKRPRLDLQNKEFKDRGKRMLGMIFNTLNQFKKDTSEKSEAEKRREEIENKLQERLKKEKKDLEEEIKQDGEIRRKKRIEEEKERLKNLVFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.29
4 0.26
5 0.27
6 0.28
7 0.29
8 0.3
9 0.33
10 0.32
11 0.39
12 0.49
13 0.53
14 0.6
15 0.67
16 0.66
17 0.66
18 0.72
19 0.7
20 0.69
21 0.7
22 0.63
23 0.63
24 0.64
25 0.59
26 0.55
27 0.49
28 0.41
29 0.39
30 0.42
31 0.41
32 0.44
33 0.51
34 0.49
35 0.54
36 0.56
37 0.59
38 0.61
39 0.61
40 0.58
41 0.6
42 0.59
43 0.59
44 0.57
45 0.51
46 0.52
47 0.48
48 0.46
49 0.4
50 0.4
51 0.37
52 0.4
53 0.37
54 0.28
55 0.27
56 0.21
57 0.17
58 0.18
59 0.17
60 0.14
61 0.13
62 0.13
63 0.11
64 0.15
65 0.18
66 0.21
67 0.26
68 0.31
69 0.31
70 0.36
71 0.45
72 0.46
73 0.47
74 0.48
75 0.43
76 0.42
77 0.47
78 0.43
79 0.42
80 0.46
81 0.51
82 0.48
83 0.52
84 0.5
85 0.48
86 0.52
87 0.54
88 0.55
89 0.53
90 0.59
91 0.62
92 0.65
93 0.69
94 0.7
95 0.69
96 0.66
97 0.6
98 0.57
99 0.49
100 0.43
101 0.4
102 0.38
103 0.39
104 0.4
105 0.43
106 0.49
107 0.52
108 0.56
109 0.62
110 0.67
111 0.68
112 0.71
113 0.76
114 0.77
115 0.82
116 0.81
117 0.72