Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZDP0

Protein Details
Accession H8ZDP0   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-39LAFRQPPKKRRQIVIIGKKGHydrophilic
NLS Segment(s)
PositionSequence
27-30KKRR
Subcellular Location(s) extr 7, mito 5, plas 4, cyto_mito 4, mito_nucl 4, nucl 3, cyto 3, cyto_nucl 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
CDD cd00882  Ras_like_GTPase  
Amino Acid Sequences MNSIFIAIVVCIVALLSAVLAFRQPPKKRRQIVIIGKKGTGKTRLFLALSNKNKEGIRTIPSVDPSKELLGRAAVLVDLPGADSFESLKDTWTLSSRDLIIYMFNKKEDENPKGVDASIPIYKIYTGKDEPWSHAIKCMCMEGLLKADLGSSEIQSVLSKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.03
5 0.03
6 0.03
7 0.04
8 0.06
9 0.13
10 0.23
11 0.31
12 0.39
13 0.5
14 0.6
15 0.67
16 0.72
17 0.74
18 0.75
19 0.78
20 0.81
21 0.8
22 0.71
23 0.65
24 0.62
25 0.56
26 0.5
27 0.46
28 0.37
29 0.29
30 0.3
31 0.32
32 0.29
33 0.3
34 0.33
35 0.35
36 0.4
37 0.42
38 0.4
39 0.4
40 0.4
41 0.37
42 0.34
43 0.27
44 0.25
45 0.23
46 0.24
47 0.23
48 0.26
49 0.28
50 0.24
51 0.23
52 0.2
53 0.2
54 0.19
55 0.17
56 0.14
57 0.12
58 0.11
59 0.09
60 0.08
61 0.06
62 0.05
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.04
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.08
79 0.11
80 0.12
81 0.11
82 0.12
83 0.12
84 0.12
85 0.12
86 0.11
87 0.11
88 0.12
89 0.15
90 0.15
91 0.15
92 0.16
93 0.16
94 0.23
95 0.27
96 0.3
97 0.3
98 0.31
99 0.32
100 0.31
101 0.31
102 0.24
103 0.18
104 0.17
105 0.15
106 0.13
107 0.12
108 0.12
109 0.13
110 0.14
111 0.14
112 0.16
113 0.17
114 0.2
115 0.28
116 0.3
117 0.33
118 0.37
119 0.39
120 0.34
121 0.38
122 0.35
123 0.29
124 0.28
125 0.26
126 0.21
127 0.18
128 0.19
129 0.15
130 0.17
131 0.16
132 0.14
133 0.13
134 0.13
135 0.11
136 0.12
137 0.11
138 0.09
139 0.09
140 0.09
141 0.1
142 0.1