Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N8W6

Protein Details
Accession A0A1Y3N8W6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
115-143LLEKYDKAENKKKRTSKGKNKKSPAEDLPHydrophilic
NLS Segment(s)
PositionSequence
123-137ENKKKRTSKGKNKKS
Subcellular Location(s) nucl 16, cyto_nucl 14, cyto 10
Family & Domain DBs
Amino Acid Sequences MLVSEEEAKEVCELYVKSKGDLEYIMDNIPLCTAEDYPRFVEIIDKAIEEKKVKKYKKYNNDYEEAMKARKDFEEKEKIKFEKAQAKEKKNQKDDLALIIQNNRKRRMESVFDNLLEKYDKAENKKKRTSKGKNKKSPAEDLPSEEEFLKLQEKLFGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.24
3 0.24
4 0.25
5 0.28
6 0.28
7 0.25
8 0.25
9 0.24
10 0.19
11 0.19
12 0.19
13 0.16
14 0.15
15 0.14
16 0.13
17 0.1
18 0.08
19 0.08
20 0.09
21 0.13
22 0.15
23 0.18
24 0.19
25 0.19
26 0.18
27 0.17
28 0.19
29 0.15
30 0.16
31 0.14
32 0.13
33 0.14
34 0.16
35 0.19
36 0.19
37 0.24
38 0.3
39 0.39
40 0.43
41 0.52
42 0.6
43 0.67
44 0.75
45 0.79
46 0.79
47 0.75
48 0.74
49 0.67
50 0.59
51 0.52
52 0.43
53 0.34
54 0.25
55 0.21
56 0.19
57 0.18
58 0.18
59 0.17
60 0.22
61 0.32
62 0.33
63 0.37
64 0.43
65 0.42
66 0.41
67 0.41
68 0.39
69 0.37
70 0.4
71 0.45
72 0.47
73 0.52
74 0.58
75 0.64
76 0.68
77 0.64
78 0.64
79 0.56
80 0.52
81 0.48
82 0.43
83 0.38
84 0.29
85 0.25
86 0.26
87 0.29
88 0.28
89 0.32
90 0.33
91 0.32
92 0.33
93 0.37
94 0.38
95 0.4
96 0.41
97 0.43
98 0.43
99 0.42
100 0.41
101 0.37
102 0.32
103 0.26
104 0.21
105 0.16
106 0.18
107 0.22
108 0.28
109 0.38
110 0.46
111 0.54
112 0.65
113 0.69
114 0.73
115 0.8
116 0.84
117 0.86
118 0.88
119 0.89
120 0.9
121 0.92
122 0.92
123 0.87
124 0.84
125 0.8
126 0.77
127 0.68
128 0.63
129 0.59
130 0.51
131 0.46
132 0.38
133 0.31
134 0.22
135 0.22
136 0.2
137 0.15
138 0.14
139 0.2
140 0.23