Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NMR0

Protein Details
Accession A0A1Y3NMR0   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MRPDPYKQKKSRRYQLTHKNKLNNKNDNNHydrophilic
46-67NNSNKIGKPKPTYNRRANRTFIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MRPDPYKQKKSRRYQLTHKNKLNNKNDNNKEQNVKEKTTDNNDINNNSNKIGKPKPTYNRRANRTFIDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.9
4 0.9
5 0.86
6 0.85
7 0.82
8 0.84
9 0.83
10 0.82
11 0.78
12 0.78
13 0.77
14 0.76
15 0.74
16 0.68
17 0.63
18 0.55
19 0.56
20 0.5
21 0.45
22 0.38
23 0.36
24 0.35
25 0.36
26 0.41
27 0.33
28 0.35
29 0.36
30 0.37
31 0.38
32 0.39
33 0.34
34 0.29
35 0.3
36 0.26
37 0.31
38 0.34
39 0.38
40 0.4
41 0.48
42 0.58
43 0.65
44 0.73
45 0.77
46 0.82
47 0.82
48 0.82
49 0.78