Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N169

Protein Details
Accession A0A1Y3N169   
Localization Confidence High
Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MDKKSTSGDKPKKESRSRSKSRSVSRSRQRSLSHydrophilic
37-70SISASRSRSRTRSRTRSRTRSRTRSRSRSRSLSSHydrophilic
84-105ASRSNSRKRSRNDSRSRNTRIIHydrophilic
NLS Segment(s)
PositionSequence
9-101DKPKKESRSRSKSRSVSRSRQRSLSMSRSISASRSRSRTRSRTRSRTRSRTRSRSRSRSLSSSRSRSKSVSKTRNASRSNSRKRSRNDSRSRN
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MDKKSTSGDKPKKESRSRSKSRSVSRSRQRSLSMSRSISASRSRSRTRSRTRSRTRSRTRSRSRSRSLSSSRSRSKSVSKTRNASRSNSRKRSRNDSRSRNTRIIVKKLTKNVNVDHLREIFGVYGTITSLDLPIDRKCKYILLKIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.86
4 0.87
5 0.86
6 0.87
7 0.86
8 0.86
9 0.86
10 0.85
11 0.84
12 0.85
13 0.87
14 0.81
15 0.77
16 0.71
17 0.67
18 0.65
19 0.62
20 0.59
21 0.5
22 0.46
23 0.43
24 0.39
25 0.36
26 0.34
27 0.32
28 0.31
29 0.36
30 0.41
31 0.47
32 0.55
33 0.62
34 0.66
35 0.72
36 0.76
37 0.81
38 0.86
39 0.89
40 0.9
41 0.91
42 0.91
43 0.91
44 0.91
45 0.91
46 0.91
47 0.91
48 0.9
49 0.89
50 0.85
51 0.83
52 0.76
53 0.74
54 0.69
55 0.67
56 0.64
57 0.62
58 0.62
59 0.57
60 0.55
61 0.49
62 0.51
63 0.51
64 0.54
65 0.55
66 0.54
67 0.59
68 0.63
69 0.7
70 0.65
71 0.6
72 0.6
73 0.62
74 0.67
75 0.7
76 0.7
77 0.69
78 0.73
79 0.79
80 0.79
81 0.79
82 0.79
83 0.79
84 0.82
85 0.84
86 0.85
87 0.79
88 0.7
89 0.68
90 0.64
91 0.62
92 0.61
93 0.59
94 0.58
95 0.62
96 0.67
97 0.64
98 0.61
99 0.56
100 0.57
101 0.53
102 0.49
103 0.46
104 0.39
105 0.36
106 0.31
107 0.29
108 0.2
109 0.15
110 0.13
111 0.09
112 0.08
113 0.06
114 0.07
115 0.06
116 0.06
117 0.06
118 0.06
119 0.08
120 0.1
121 0.16
122 0.21
123 0.22
124 0.23
125 0.25
126 0.31
127 0.35