Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N5U0

Protein Details
Accession A0A1Y3N5U0    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-28EIFKLTKAIKKFRTRRSKNHTALLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002108  ADF-H  
IPR029006  ADF-H/Gelsolin-like_dom_sf  
Gene Ontology GO:0003779  F:actin binding  
Pfam View protein in Pfam  
PF00241  Cofilin_ADF  
PROSITE View protein in PROSITE  
PS51263  ADF_H  
Amino Acid Sequences MYLIEIFKLTKAIKKFRTRRSKNHTALLIRIDEENLVIEQDELIEDVDLENFCDELPDVDPRYPFITFIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.61
3 0.68
4 0.78
5 0.8
6 0.85
7 0.85
8 0.87
9 0.81
10 0.79
11 0.75
12 0.66
13 0.6
14 0.52
15 0.43
16 0.33
17 0.27
18 0.2
19 0.13
20 0.11
21 0.09
22 0.06
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.08
44 0.13
45 0.15
46 0.18
47 0.18
48 0.2
49 0.23
50 0.22