Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N0A5

Protein Details
Accession A0A1Y3N0A5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21EKRRRRRESHNAVERRRRDNIBasic
NLS Segment(s)
PositionSequence
2-16KRRRRRESHNAVERR
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
CDD cd11387  bHLHzip_USF_MITF  
Amino Acid Sequences EKRRRRRESHNAVERRRRDNINEKIHELSTLIPEHILNPNNGEGPVGKPNKGIILRKSVEYIKHLQALVEKQEAKNKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.75
4 0.68
5 0.66
6 0.66
7 0.67
8 0.67
9 0.64
10 0.61
11 0.57
12 0.53
13 0.45
14 0.35
15 0.26
16 0.18
17 0.15
18 0.12
19 0.1
20 0.1
21 0.11
22 0.15
23 0.15
24 0.12
25 0.12
26 0.13
27 0.13
28 0.13
29 0.12
30 0.08
31 0.1
32 0.17
33 0.18
34 0.17
35 0.17
36 0.18
37 0.24
38 0.28
39 0.3
40 0.25
41 0.33
42 0.34
43 0.35
44 0.38
45 0.35
46 0.33
47 0.33
48 0.35
49 0.3
50 0.33
51 0.32
52 0.29
53 0.31
54 0.33
55 0.33
56 0.34
57 0.34
58 0.32