Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N9W5

Protein Details
Accession A0A1Y3N9W5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
177-208NWENCKKCLIERYPRIKRLNKIREKQNKAKGEHydrophilic
NLS Segment(s)
PositionSequence
192-207IKRLNKIREKQNKAKG
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Pfam View protein in Pfam  
PF14223  Retrotran_gag_2  
Amino Acid Sequences MNSDEIYSIKSNVTEKLTEETYLDWSSDMLLLLSTKGLDEYVFEQKVKIISKSSEEYKETCRKIVGTTDCFYNDGATVEDIKNDNKVKYFMKKIGLLEKTHKKGNEERKISYKQELEEMKFDKEGDIDLYLSNMENIFENLKDLGDEPSEESKYNYLYNSLPKSVIHETGLVAYQDNWENCKKCLIERYPRIKRLNKIREKQNKAKGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.26
4 0.27
5 0.25
6 0.24
7 0.21
8 0.22
9 0.21
10 0.19
11 0.14
12 0.13
13 0.13
14 0.12
15 0.11
16 0.07
17 0.06
18 0.06
19 0.07
20 0.07
21 0.06
22 0.05
23 0.05
24 0.06
25 0.05
26 0.07
27 0.1
28 0.17
29 0.19
30 0.19
31 0.19
32 0.2
33 0.25
34 0.26
35 0.24
36 0.2
37 0.2
38 0.25
39 0.29
40 0.32
41 0.33
42 0.33
43 0.33
44 0.38
45 0.45
46 0.42
47 0.39
48 0.35
49 0.31
50 0.31
51 0.36
52 0.35
53 0.3
54 0.3
55 0.31
56 0.3
57 0.3
58 0.28
59 0.21
60 0.15
61 0.1
62 0.1
63 0.08
64 0.1
65 0.09
66 0.11
67 0.12
68 0.11
69 0.16
70 0.17
71 0.17
72 0.16
73 0.19
74 0.21
75 0.26
76 0.3
77 0.29
78 0.31
79 0.34
80 0.34
81 0.39
82 0.39
83 0.35
84 0.38
85 0.42
86 0.41
87 0.41
88 0.4
89 0.36
90 0.4
91 0.49
92 0.51
93 0.47
94 0.47
95 0.5
96 0.54
97 0.53
98 0.5
99 0.41
100 0.32
101 0.35
102 0.35
103 0.3
104 0.3
105 0.3
106 0.26
107 0.24
108 0.23
109 0.17
110 0.14
111 0.13
112 0.09
113 0.08
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.05
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.07
127 0.07
128 0.07
129 0.07
130 0.08
131 0.08
132 0.08
133 0.09
134 0.11
135 0.15
136 0.16
137 0.16
138 0.16
139 0.16
140 0.17
141 0.18
142 0.16
143 0.14
144 0.15
145 0.22
146 0.25
147 0.25
148 0.24
149 0.23
150 0.28
151 0.29
152 0.29
153 0.23
154 0.2
155 0.19
156 0.2
157 0.21
158 0.16
159 0.13
160 0.11
161 0.13
162 0.17
163 0.17
164 0.19
165 0.25
166 0.26
167 0.27
168 0.33
169 0.31
170 0.31
171 0.4
172 0.46
173 0.5
174 0.59
175 0.69
176 0.73
177 0.81
178 0.85
179 0.83
180 0.83
181 0.84
182 0.85
183 0.84
184 0.83
185 0.86
186 0.88
187 0.9
188 0.91