Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NS94

Protein Details
Accession A0A1Y3NS94    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-56QRINIKKKKVSNNLIKTRTKKHydrophilic
NLS Segment(s)
PositionSequence
42-44KKK
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MCNKEGHEKRNYDVMETNLFQYQRPIDRKGIIVFTQRINIKKKKVSNNLIKTRTKKGKLVGIYTIKEKEISV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.32
4 0.31
5 0.26
6 0.26
7 0.23
8 0.22
9 0.22
10 0.25
11 0.28
12 0.31
13 0.3
14 0.31
15 0.34
16 0.32
17 0.32
18 0.26
19 0.26
20 0.24
21 0.22
22 0.25
23 0.25
24 0.28
25 0.31
26 0.35
27 0.37
28 0.42
29 0.49
30 0.54
31 0.62
32 0.67
33 0.71
34 0.76
35 0.8
36 0.8
37 0.8
38 0.75
39 0.75
40 0.76
41 0.7
42 0.64
43 0.6
44 0.61
45 0.59
46 0.59
47 0.57
48 0.54
49 0.52
50 0.52
51 0.49
52 0.41