Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N0V8

Protein Details
Accession A0A1Y3N0V8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
26-51FSSLKTKSSTKKKKERKNVVIHNIILHydrophilic
NLS Segment(s)
PositionSequence
35-42TKKKKERK
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MKPPDERYCYSFKCLYSSTLIDLSLFSSLKTKSSTKKKKERKNVVIHNIILTPIRGVDDDDENSTGHSKIQGRNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.32
4 0.3
5 0.27
6 0.24
7 0.23
8 0.18
9 0.17
10 0.15
11 0.12
12 0.11
13 0.08
14 0.1
15 0.1
16 0.12
17 0.15
18 0.17
19 0.24
20 0.35
21 0.45
22 0.52
23 0.63
24 0.71
25 0.78
26 0.86
27 0.89
28 0.88
29 0.88
30 0.88
31 0.85
32 0.81
33 0.71
34 0.61
35 0.5
36 0.41
37 0.3
38 0.21
39 0.13
40 0.08
41 0.08
42 0.07
43 0.08
44 0.09
45 0.13
46 0.14
47 0.16
48 0.17
49 0.16
50 0.17
51 0.17
52 0.15
53 0.13
54 0.17
55 0.2