Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NG16

Protein Details
Accession A0A1Y3NG16   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
89-121QRIQRSFRKIRGKRYENEKRSPPLKRAKKGEKKBasic
NLS Segment(s)
PositionSequence
94-121SFRKIRGKRYENEKRSPPLKRAKKGEKK
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
Amino Acid Sequences MKFKNINLLIIVLTYVITTTSLPIKNKQIYGVVTNNSVVIEKTDKKINLSLKKRSPLKKIAGYAGTFEIRPTDDVGEKIESADIELAGQRIQRSFRKIRGKRYENEKRSPPLKRAKKGEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.06
7 0.12
8 0.17
9 0.19
10 0.24
11 0.32
12 0.35
13 0.36
14 0.37
15 0.35
16 0.32
17 0.35
18 0.35
19 0.28
20 0.25
21 0.24
22 0.23
23 0.19
24 0.17
25 0.12
26 0.1
27 0.13
28 0.14
29 0.16
30 0.21
31 0.21
32 0.23
33 0.28
34 0.35
35 0.4
36 0.44
37 0.51
38 0.51
39 0.59
40 0.65
41 0.65
42 0.64
43 0.62
44 0.62
45 0.59
46 0.55
47 0.5
48 0.45
49 0.39
50 0.34
51 0.28
52 0.22
53 0.16
54 0.14
55 0.11
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.1
62 0.12
63 0.13
64 0.12
65 0.12
66 0.11
67 0.09
68 0.09
69 0.09
70 0.06
71 0.05
72 0.06
73 0.06
74 0.06
75 0.08
76 0.08
77 0.1
78 0.15
79 0.19
80 0.27
81 0.33
82 0.42
83 0.52
84 0.57
85 0.67
86 0.73
87 0.75
88 0.76
89 0.81
90 0.83
91 0.8
92 0.82
93 0.79
94 0.76
95 0.77
96 0.76
97 0.74
98 0.74
99 0.76
100 0.77
101 0.8