Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZCT7

Protein Details
Accession H8ZCT7   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
244-263SKWSCFFRNKLPQEKTKQVKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10cyto_nucl 10, mito 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
PROSITE View protein in PROSITE  
PS50280  SET  
CDD cd10529  SET_SETD5-like  
Amino Acid Sequences MLLRVGLQQCYDENCFNNQKEGVITTEELYVQPSKTYCNKCMDGGLDYVYTSDIMFNKEGVWQSNLKLNIGELVEDSLILRKIKRRGFIQNGASYYGLFSKKEYSPNEIVGFIGGAISNINMVGTGNARKAKSPSRCFIFRDCGLVIDSRKSGNLVRFIRRSCRPNVAISLEVCEEGWKGHPPLKKNPFLVTAIRAKLYALSRIESAQELFIGNDYSSHASEEWMSTELDVTGDDLVDSCSCNSKWSCFFRNKLPQEKTKQVKIKSKISPIFVRMKKYTKEKVPFTPSDMAYVLNRKCTFIKSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.38
4 0.41
5 0.37
6 0.34
7 0.32
8 0.32
9 0.27
10 0.22
11 0.22
12 0.18
13 0.18
14 0.18
15 0.16
16 0.17
17 0.17
18 0.14
19 0.16
20 0.15
21 0.2
22 0.28
23 0.35
24 0.37
25 0.43
26 0.45
27 0.44
28 0.47
29 0.43
30 0.37
31 0.32
32 0.28
33 0.2
34 0.18
35 0.17
36 0.13
37 0.11
38 0.09
39 0.1
40 0.09
41 0.12
42 0.12
43 0.12
44 0.12
45 0.16
46 0.17
47 0.17
48 0.19
49 0.18
50 0.18
51 0.24
52 0.24
53 0.21
54 0.2
55 0.18
56 0.18
57 0.16
58 0.15
59 0.1
60 0.1
61 0.09
62 0.09
63 0.09
64 0.08
65 0.11
66 0.11
67 0.13
68 0.18
69 0.26
70 0.31
71 0.36
72 0.39
73 0.47
74 0.55
75 0.61
76 0.62
77 0.59
78 0.56
79 0.52
80 0.47
81 0.37
82 0.29
83 0.25
84 0.19
85 0.14
86 0.14
87 0.17
88 0.19
89 0.26
90 0.28
91 0.3
92 0.31
93 0.35
94 0.35
95 0.3
96 0.27
97 0.2
98 0.18
99 0.11
100 0.08
101 0.05
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.05
112 0.06
113 0.09
114 0.13
115 0.13
116 0.15
117 0.18
118 0.26
119 0.34
120 0.39
121 0.41
122 0.43
123 0.47
124 0.48
125 0.49
126 0.47
127 0.39
128 0.36
129 0.31
130 0.26
131 0.24
132 0.23
133 0.19
134 0.14
135 0.14
136 0.11
137 0.11
138 0.11
139 0.13
140 0.14
141 0.21
142 0.23
143 0.28
144 0.31
145 0.33
146 0.38
147 0.41
148 0.42
149 0.38
150 0.42
151 0.39
152 0.37
153 0.39
154 0.36
155 0.32
156 0.28
157 0.26
158 0.19
159 0.17
160 0.14
161 0.11
162 0.08
163 0.07
164 0.08
165 0.09
166 0.1
167 0.15
168 0.18
169 0.22
170 0.32
171 0.4
172 0.44
173 0.44
174 0.46
175 0.44
176 0.44
177 0.42
178 0.36
179 0.34
180 0.29
181 0.27
182 0.24
183 0.21
184 0.22
185 0.21
186 0.22
187 0.17
188 0.17
189 0.18
190 0.18
191 0.19
192 0.16
193 0.15
194 0.1
195 0.09
196 0.08
197 0.08
198 0.08
199 0.08
200 0.07
201 0.07
202 0.08
203 0.1
204 0.1
205 0.11
206 0.1
207 0.1
208 0.11
209 0.11
210 0.11
211 0.1
212 0.1
213 0.09
214 0.09
215 0.08
216 0.08
217 0.07
218 0.06
219 0.05
220 0.05
221 0.05
222 0.05
223 0.06
224 0.06
225 0.07
226 0.07
227 0.11
228 0.11
229 0.16
230 0.17
231 0.21
232 0.29
233 0.35
234 0.42
235 0.46
236 0.5
237 0.56
238 0.65
239 0.69
240 0.72
241 0.72
242 0.74
243 0.75
244 0.81
245 0.78
246 0.77
247 0.77
248 0.75
249 0.78
250 0.76
251 0.77
252 0.75
253 0.78
254 0.73
255 0.72
256 0.69
257 0.65
258 0.68
259 0.63
260 0.62
261 0.59
262 0.61
263 0.62
264 0.65
265 0.68
266 0.68
267 0.73
268 0.72
269 0.75
270 0.76
271 0.72
272 0.69
273 0.67
274 0.58
275 0.52
276 0.46
277 0.38
278 0.34
279 0.39
280 0.34
281 0.36
282 0.36
283 0.35
284 0.37