Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MVB3

Protein Details
Accession A0A1Y3MVB3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
35-55QGSSTWTKKKQRNINALKYDQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKVSNNDYNDNIYYKDEDLSYINILTIFIHHCFNQGSSTWTKKKQRNINALKYDQTQKGNYIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.16
4 0.15
5 0.15
6 0.15
7 0.14
8 0.12
9 0.11
10 0.09
11 0.09
12 0.08
13 0.08
14 0.07
15 0.08
16 0.09
17 0.09
18 0.1
19 0.1
20 0.11
21 0.11
22 0.1
23 0.12
24 0.15
25 0.22
26 0.26
27 0.35
28 0.43
29 0.48
30 0.57
31 0.64
32 0.7
33 0.74
34 0.79
35 0.81
36 0.81
37 0.78
38 0.72
39 0.68
40 0.64
41 0.59
42 0.54
43 0.46