Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8ZAR5

Protein Details
Accession H8ZAR5    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAGKKVDPKAQLKKKDKAPKKVETKKWTKTESKBasic
NLS Segment(s)
PositionSequence
5-33KVDPKAQLKKKDKAPKKVETKKWTKTESK
Subcellular Location(s) nucl 18, cyto 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAGKKVDPKAQLKKKDKAPKKVETKKWTKTESKAKQLKTSVITQDIFNKIKKEILAMALITPATIAARNNFEIALAKNILDQIVESGEIEIIAKSSFGRIYGKKETKEVKEIKEETVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.85
4 0.85
5 0.84
6 0.83
7 0.86
8 0.88
9 0.88
10 0.87
11 0.87
12 0.86
13 0.85
14 0.82
15 0.78
16 0.76
17 0.77
18 0.76
19 0.77
20 0.75
21 0.7
22 0.7
23 0.66
24 0.61
25 0.53
26 0.5
27 0.42
28 0.39
29 0.36
30 0.3
31 0.32
32 0.32
33 0.31
34 0.28
35 0.26
36 0.22
37 0.23
38 0.22
39 0.19
40 0.14
41 0.14
42 0.13
43 0.11
44 0.11
45 0.09
46 0.09
47 0.07
48 0.06
49 0.04
50 0.03
51 0.04
52 0.04
53 0.06
54 0.08
55 0.09
56 0.09
57 0.09
58 0.09
59 0.1
60 0.11
61 0.12
62 0.1
63 0.1
64 0.1
65 0.1
66 0.1
67 0.08
68 0.07
69 0.05
70 0.05
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.07
84 0.08
85 0.14
86 0.17
87 0.24
88 0.35
89 0.42
90 0.42
91 0.5
92 0.56
93 0.57
94 0.64
95 0.63
96 0.59
97 0.62
98 0.62
99 0.58