Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8Z9P7

Protein Details
Accession H8Z9P7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-40KEDSKVKKTFDQDRKRKDKVKNDKAFRLHSDBasic
NLS Segment(s)
PositionSequence
24-29KRKDKV
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045117  ATXN2-like  
IPR009604  LsmAD_domain  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF06741  LsmAD  
Amino Acid Sequences MFTKHMNLHKEDSKVKKTFDQDRKRKDKVKNDKAFRLHSDIKKGDFYKVILHNNECRTGRLVDMTDKEIRFSEYTESDSTVAYEYTHKIEDIASLEPMILSLRKESSNIKNNVVIVTMRTGTTGYGELQKETKDCLVLNNFVFFSDAYIPYDITIKKVLIRDYLKLSVPVSEPIDSEKLEKSFQIDSEVGKKRFGKAKELQSFYASGEAPQKEAISKSHNGKEVWNQFEANEKLFGMKATFDESVYTTVLDKNSKEYKKYAYEAECIARRIDNPTSSNLHMEEERGRISNAGEDEKSMDLHSLDMTPAEIQKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.61
3 0.61
4 0.64
5 0.68
6 0.7
7 0.73
8 0.74
9 0.8
10 0.86
11 0.88
12 0.88
13 0.87
14 0.88
15 0.88
16 0.89
17 0.88
18 0.87
19 0.87
20 0.85
21 0.82
22 0.76
23 0.73
24 0.71
25 0.66
26 0.67
27 0.61
28 0.57
29 0.58
30 0.54
31 0.49
32 0.43
33 0.39
34 0.37
35 0.41
36 0.45
37 0.42
38 0.45
39 0.48
40 0.48
41 0.54
42 0.46
43 0.41
44 0.38
45 0.34
46 0.31
47 0.28
48 0.27
49 0.25
50 0.27
51 0.3
52 0.32
53 0.31
54 0.31
55 0.28
56 0.28
57 0.23
58 0.22
59 0.22
60 0.17
61 0.21
62 0.21
63 0.21
64 0.19
65 0.18
66 0.17
67 0.14
68 0.12
69 0.1
70 0.11
71 0.11
72 0.13
73 0.13
74 0.12
75 0.12
76 0.12
77 0.13
78 0.13
79 0.12
80 0.1
81 0.1
82 0.1
83 0.09
84 0.09
85 0.08
86 0.06
87 0.06
88 0.07
89 0.09
90 0.1
91 0.12
92 0.18
93 0.26
94 0.34
95 0.37
96 0.38
97 0.38
98 0.38
99 0.37
100 0.32
101 0.23
102 0.14
103 0.13
104 0.11
105 0.09
106 0.09
107 0.09
108 0.08
109 0.09
110 0.09
111 0.08
112 0.13
113 0.13
114 0.13
115 0.14
116 0.15
117 0.15
118 0.15
119 0.15
120 0.11
121 0.1
122 0.13
123 0.15
124 0.17
125 0.17
126 0.17
127 0.16
128 0.15
129 0.16
130 0.12
131 0.1
132 0.09
133 0.1
134 0.09
135 0.1
136 0.1
137 0.09
138 0.13
139 0.11
140 0.1
141 0.11
142 0.1
143 0.13
144 0.15
145 0.16
146 0.18
147 0.2
148 0.21
149 0.23
150 0.25
151 0.23
152 0.22
153 0.21
154 0.17
155 0.16
156 0.16
157 0.14
158 0.12
159 0.12
160 0.13
161 0.14
162 0.13
163 0.14
164 0.13
165 0.13
166 0.13
167 0.13
168 0.14
169 0.14
170 0.14
171 0.16
172 0.15
173 0.15
174 0.23
175 0.31
176 0.29
177 0.31
178 0.32
179 0.33
180 0.39
181 0.4
182 0.4
183 0.4
184 0.5
185 0.54
186 0.56
187 0.53
188 0.47
189 0.46
190 0.38
191 0.34
192 0.23
193 0.16
194 0.19
195 0.18
196 0.17
197 0.17
198 0.17
199 0.15
200 0.16
201 0.17
202 0.16
203 0.21
204 0.27
205 0.31
206 0.36
207 0.35
208 0.37
209 0.44
210 0.47
211 0.45
212 0.4
213 0.36
214 0.31
215 0.39
216 0.37
217 0.29
218 0.22
219 0.19
220 0.18
221 0.18
222 0.18
223 0.11
224 0.1
225 0.09
226 0.12
227 0.13
228 0.12
229 0.13
230 0.14
231 0.15
232 0.14
233 0.14
234 0.11
235 0.13
236 0.15
237 0.17
238 0.16
239 0.22
240 0.31
241 0.34
242 0.36
243 0.38
244 0.42
245 0.46
246 0.49
247 0.5
248 0.44
249 0.44
250 0.44
251 0.47
252 0.43
253 0.38
254 0.36
255 0.3
256 0.27
257 0.3
258 0.32
259 0.31
260 0.29
261 0.33
262 0.37
263 0.37
264 0.38
265 0.33
266 0.31
267 0.25
268 0.26
269 0.25
270 0.24
271 0.24
272 0.23
273 0.22
274 0.2
275 0.2
276 0.23
277 0.22
278 0.24
279 0.22
280 0.22
281 0.23
282 0.23
283 0.23
284 0.19
285 0.17
286 0.12
287 0.13
288 0.13
289 0.12
290 0.11
291 0.1
292 0.11
293 0.11
294 0.15