Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NIJ1

Protein Details
Accession A0A1Y3NIJ1   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-45WVSPLSNKLNEKKRKKKKSNIKFDSVIHydrophilic
NLS Segment(s)
PositionSequence
29-37EKKRKKKKS
Subcellular Location(s) mito 20, mito_nucl 12.833, cyto_mito 11.833, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MKRSFMQRSPKDSISCTVWVSPLSNKLNEKKRKKKKSNIKFDSVITTTLSHESLMFSFNKFLTSDPEYETNSRMVLVRKVARPSINGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.36
4 0.3
5 0.25
6 0.23
7 0.22
8 0.21
9 0.24
10 0.25
11 0.27
12 0.31
13 0.38
14 0.47
15 0.55
16 0.63
17 0.66
18 0.75
19 0.82
20 0.88
21 0.9
22 0.92
23 0.92
24 0.93
25 0.88
26 0.84
27 0.75
28 0.66
29 0.6
30 0.49
31 0.39
32 0.29
33 0.23
34 0.17
35 0.15
36 0.14
37 0.1
38 0.09
39 0.09
40 0.08
41 0.09
42 0.09
43 0.08
44 0.1
45 0.1
46 0.11
47 0.11
48 0.11
49 0.15
50 0.17
51 0.18
52 0.2
53 0.23
54 0.25
55 0.26
56 0.27
57 0.22
58 0.19
59 0.18
60 0.18
61 0.18
62 0.19
63 0.25
64 0.3
65 0.35
66 0.39
67 0.44
68 0.44